KEGG   Mus musculus (mouse): 74558
Entry
74558             CDS       T01002                                 

Symbol
Gvin1, 9130002C22Rik, 9830104F22Rik, Iigs1, VLIG, VLIG-1
Name
(RefSeq) GTPase, very large interferon inducible 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: RHD3_GTPase Dynamin_N MMR_HSR1 DUF4853
Other DBs
NCBI-GeneID: 74558
NCBI-ProteinID: NP_001034249
MGI: 1921808
Ensembl: ENSMUSG00000045868
Vega: OTTMUSG00000044633
UniProt: L7N451
Position
7:complement(105755742..105814547)
AA seq 2427 aa
MATAKCFTDEPQLQSRRKHNLQEMLTEVGLSVDYWLPKLQEDLGVTSAQALQYLDRNDLQ
KLKSQTTHTWEKRALEKLLDFSQPNSVAELQETPREMKKNRQRQAGQALQALKALQSEGK
HREEEAVRRKEAELRQAMEIPEECWPTAEVSLKDITEIMERHLSHMERTLAHSPNLSDGD
LVRWASGGLALQGIYKTNHPRSLIQKREELLSVPKQFSLVGPEHGTEIKTMEFSSFHEQA
MFTETIKMMGFSSTSLVKGEGWGFSLEAGIDQNEQTASENTHQSHSEQTYFCSARFSYIP
LATCHFHINDLELSNAALQELKTIEELLEQTTDHRDGLPLLRHRAENFFHRFGSHANQGP
LQLGGIYCWKAISEGFKSEHLADVKQQTRESLNIYIMGSYSGFGVKVGASVNIANSNSET
ASFSTTHLHSQTKVQLSVAQIGGPAEADGIAQWTAGLVVSNQTWSVIDRELQLVPIWDII
LSSHRTDFKNALQVANCLKDNYTALTELDAQIQEGEEFLTARKEAKLFIEDVKCWEVSDP
EEQLTKLLDFMQTLSQKIKSYNIWINTCLTDWDLQNFLINTVKFCKTSPTYKTQFIKSQL
CSLLEPHVYKVTNFPEAHSIIQWINQSEYGEEQVKITSFSEFIKTLKKTHKYLMEVNFKN
EAPETVEEAERTATYEVTTALSSFLKYLKETEQPDMQLLLLSIAAGAGYQLVNSIFQHLL
GCDELNFLLDQMQSNQHKYQELKNICNYRAQAFLVLTALRTTVEITDISTEEKRQRLALI
KQHMGTLLSEEVAHVLTKHGEHHDWESLENDLRLLIEGDYKATTHYLQMDEVKKQLQSLC
HGKKQTYKQKSNENITKGMIENGPFLKLLQRLGLDNYYPKRMSRADFHLIYKTSVYNSQP
RSEKELPFYFLQKLLMLDYGFRHLIVKDDENIKKQISIGSSNHENEDIDPYDDVIIDNDS
PGYPSATESWPHIHPLDIQMTILHCADDLTRQYIFSKLSICHYALPLVVPNPNTSQIEFY
LWSLRQIRKSWQDASKSPQDKSYSHRNQQMCRVSTPIVSFIRVGNDLSASKSQIMNSLLS
KRKHDVFFHRHCKGSNKHCLLMQGVVEICWFCPAGQGEDTFENCLTFTSLHGDAKEHTQQ
LSFLQHVSSIIVVLMSVSDNNKENQKLVRHLWQSSTPLICLIDDKEKAIANTSGKRMRIG
IKNRNEAELTEELTNAIKHFLELSNTVLSLEDCSQTARELGFIIDEDQRDCKEAKEKAQT
VMALLEEYKLSQTKENLLPLQGQLWHLWCKKDKEFYHLREKGNRSIEQHKSEIETHKRKI
RRQQLEKAFPLNDLMRSVLELLQDYSETHNKLYVLQWLTLFFDNLTIDHLDKLHERQRSL
WLRIQTEKQRAQKSNSVQNQIEAISTEIHNCTLGIEHLLREVGQIYEALEETSSSRDSLF
LCLPQIAADLMIAGVPIELMDGDASYVPLKWVAAIFDKITEKVGDKRLFVLSVLGLQSSG
KSTLLNALFGLQFTVSAGRCTKGAYMQLLKVEETFTEELGFNYVLVIDTEGLRAPELNNK
SQNWDHELATLVIGLGNLTLINIFGENPSDIQDILQISVQAFLRMKQVKISPSCLFVHQN
VGEVTAKDQTMEGRRRLEQKLDEMTALAAELEECSNITRFSDVIKFDANRHVYYFAHLWD
GNPPMAPPNPRYSYNVQELRNEILSTAQQESRGRILKISDFKFRVQDLWKALVSENFIFS
FRNTQEVIAMSKLETKYNEWTWELRSHVLDLQNQLDNQIQNGKILTLTSNLLEEPLSRKL
KTIKEEFDKYFEEDPDCEILVQWKANFEHKLLILKDSLISDTRQKCNEHISLKNSQEILD
NQKSQYENQLLERSRKLALNLKGKELSDEELHEKFRQLWTSWIYDVSSNVPHVTEPNIDL
DSENILLEYFKKDKNIVERLKIKSQGKFEIMYDKHIQMKKKYLLLRKSLETCHVESIKKT
TNNIQLKFTETLTNIWKQKRDYSQNYFHEILRIIENELKSEPCEGDYTFTKDYIIDLSLY
LFQRASKDFKKMHAAFKTANDPVNYLERKKDDFFMSFKISCQGATSITSFVDFLWLKLTP
AISVSIWKIMVQKIAGDMRATCPEFNGNRANLEIHILYSLAEEEKFDKYWKYIQKPEEFF
RDYIRDHIKRYCSEKESEKIKTFLNISLGDIKNTILSAIHNSTKVAKAKGSTASHWLDLF
CDHLGSNLVFPRKDLVSIEHQELMDTEFLKEAMSKALDPAMREVEEDCSSKHIDEIVPDI
EKILSEHLCGCWKQCPFCKAICTNTIPQHEGDHSVPFHRPQAVSGWHWHKTDQFHINVCT
SSVASNISFILDGFREFPLKKYREAGGDYATWSITPDSSTQPYWKWFVCHFRSNLEENYG
KKFTGKGSLPDLWTKITKQEVLNDLKK
NT seq 7284 nt   +upstreamnt  +downstreamnt
atggcaacagcaaagtgtttcactgatgagcctcagctacaaagcagaaggaagcacaat
ctccaggagatgctgacagaagtgggactgtctgttgactactggttacctaagcttcag
gaagatctgggtgtcacctcggcccaggccttacaatatttagacaggaatgacctccag
aagctgaagtcccagacaacacacacatgggagaaaagggcgctggagaagttactggac
ttctcacagccaaacagtgttgcagagctacaggagactccaagggagatgaaaaagaac
aggcagaggcaggcaggacaagcactgcaggctctgaaagccttgcagtcagaagggaag
cacagagaggaagaggcagtgaggagaaaagaagcagagctgagacaagcaatggagatc
cctgaggagtgctggccaacggctgaagtgtccctaaaagacatcactgaaataatggag
agacatctcagtcacatggaacggaccctggctcacagtccaaacctctcagatggagac
ctggtaagatgggcatctggagggctggctctgcagggaatttataagaccaaccaccca
agaagcctgattcagaagagagaagagctactcagtgtccctaagcagttctcacttgtt
ggcccagaacatggcaccgaaataaaaacgatggaattttcatcttttcacgaacaagcc
atgtttacagagactataaagatgatgggtttcagttcaacctccttggttaaaggcgaa
ggatggggatttagtctagaagctggtatagatcaaaacgaacagacagcatctgagaat
acacaccaatcccattcagagcaaacttatttttgctcagccaggttcagctacatccca
ttggccacgtgccattttcacatcaatgatcttgaactctccaatgctgctctccaggaa
ctaaaaactattgaagaactcctggagcagacaacagaccaccgagatggactaccctta
ctaaggcacagggctgaaaactttttccataggtttggctctcatgctaaccaaggccct
ctgcaactgggtggaatctactgctggaaagccatttcagaaggtttcaaaagtgagcac
ttggctgatgtaaagcagcaaacaagagagtctttgaatatttacattatgggcagttat
agtggctttggagttaaagtcggtgcaagtgttaatatagcaaactcaaattcagaaaca
gcatcattcagtacaactcatctacactctcaaaccaaggtacaactatctgtagcccag
ataggtggaccagcagaagcagatggaattgcccagtggacagctggccttgtagttagc
aatcaaacctggtctgtcattgatagggaactgcagttggtacctatttgggacatcatc
ctgtctagccacagaactgattttaagaatgctcttcaagtggctaactgcctaaaagac
aactacactgctctgactgaactagatgcccagattcaagagggggaagaatttctgact
gctagaaaagaagctaagcttttcatagaggatgtgaaatgctgggaggtttctgatcct
gaagaacaacttacaaagttattagattttatgcaaacattgagtcaaaaaataaaaagt
tataacatttggattaatacatgtctcactgattgggatctgcagaattttctaataaat
actgtaaagttctgcaaaacttcacccacttataaaactcagtttattaaatctcagttg
tgcagccttctagaacctcatgtctacaaagttacaaactttcctgaggcacactccatc
atacagtggatcaatcagtcagagtatggggaagagcaagtcaaaatcacctcattttct
gaattcattaagaccttaaagaaaacccacaaatacctgatggaagtgaatttcaaaaat
gaggccccagaaacagtggaagaagcagaaagaacggctacatatgaggtcaccacagct
ctcagctccttcttgaagtacctcaaagaaacagaacagccagacatgcagctgctgctg
ctttccattgcagctggtgcaggctatcagttggtaaacagtatttttcagcatcttctg
gggtgtgatgagttaaacttcctcttggatcaaatgcaaagtaaccaacacaaataccaa
gagcttaaaaatatttgcaactacagagcccaggcattcctggtgctcacagctctaaga
accacagttgaaatcacagatatttctacagaagagaaaagacaacgtttggcattaatt
aaacaacatatggggacactgttgtctgaagaagttgcacatgttctcacaaaacatgga
gaacatcatgactgggaaagtctggagaatgatttgagactactcattgagggggactat
aaagccaccacccattacttacaaatggatgaggtaaaaaaacaattgcaaagtctctgc
catggaaagaaacagacctataaacaaaaaagtaatgaaaacatcacaaaaggaatgata
gaaaatggacctttcctgaaattactccaacgtctaggcctagacaattactatccaaaa
aggatgagcagagctgacttccatctgatctataagacctctgtgtacaattcacagcca
aggtctgaaaaggagcttccattctatttcctacaaaagctactgatgttggattatggg
ttcagacatctgatagtcaaagatgatgaaaacataaaaaaacaaatctccataggttcc
tccaatcacgaaaatgaagatattgatccatatgacgatgtcattatagacaatgatagt
cctggctatccttcagccactgagtcctggccccacattcacccattggatatccagatg
accattttacactgtgcagatgatcttaccaggcaatatattttctctaaactttccatt
tgtcattatgcactcccccttgtggtaccaaatcccaacacttctcagattgaattttat
ctttggtctctcagacaaattaggaaaagttggcaagatgcaagtaaatctccacaggac
aagagctacagtcacagaaatcagcagatgtgtcgtgtctctacccccattgtgtccttc
attagagttggaaatgacctctctgcttccaaatctcagatcatgaactctcttctcagt
aaacgtaaacatgacgtgttttttcacagacactgcaaaggaagcaacaaacactgtctc
ctgatgcagggagtggtggaaatctgctggttctgtcctgccggccaaggtgaggacacg
tttgaaaattgtctgaccttcaccagtcttcatggagatgcaaaggaacacacccaacaa
ctcagcttcctccaacatgtctcttctatcattgtggtcctcatgtcagtttctgataac
aataaagaaaaccaaaagcttgtcagacacctctggcagtcatcaacacctttgatctgc
ttgattgatgacaaagaaaaggccatagcaaatacttctggtaaaagaatgagaattggc
atcaagaatagaaatgaggcagaattaacagaggagctcaccaatgccatcaaacatttt
ctagagctctctaacactgttctcagtttagaggactgttcacagacagctagagagcta
ggattcattattgatgaagaccagagagactgcaaggaagccaaagaaaaggctcagact
gtaatggccctcctggaggaatacaagttatctcagacaaaagaaaatttactacccctt
caaggacaactttggcacctttggtgtaagaaagacaaagaattctatcatctgagagaa
aaggggaatcggagcatcgaacaacacaagagtgagattgaaacacataaaagaaaaatt
cgacgtcaacagttggaaaaagcctttcctctcaatgatttaatgcgctctgttctcgaa
ctcctccaagactattcagaaacacataacaaactctacgttttgcagtggctcactctg
ttttttgacaacctgacaatagatcacctggacaaattacatgaaaggcagagatctttg
tggttaaggatacaaacagaaaagcaaagagcacagaagagcaactctgtgcagaatcag
atagaagccatctccacagagattcataactgtactttaggaattgagcaccttctccga
gaagttggccagatctatgaagctctggaagaaacttcctcctctagagatagccttttt
ctctgcctccctcaaattgctgcagacctgatgatagctggtgttcccattgagctgatg
gacggggatgcttcatatgtgcctctaaagtgggtagcagctatttttgacaagatcaca
gagaaagttggagacaaaaggctgtttgttctctctgtccttggcctgcagagctcaggg
aagtctaccctactgaatgccctgtttggcctacagttcacagtcagtgcaggcaggtgt
accaagggggcctacatgcagctcctgaaggtggaagagacattcacagaagaacttggc
tttaattatgtgcttgttatagacacagaaggacttcgagctccagaactcaacaacaaa
tcccagaattgggaccatgagttggcaacattagtcattggccttggaaacttgactctg
atcaatatttttggggagaatccctcagacattcaggacattctacaaatatctgttcaa
gcatttctgagaatgaaacaagtgaaaatctcccccagttgcctctttgtccatcagaat
gtgggagaagttacagcaaaagaccaaactatggaaggacggaggagactggagcagaaa
ctggatgaaatgactgcattggctgctgagttggaagagtgttccaacataacccgcttc
agtgatgtaattaagtttgatgccaatcgacatgtctactactttgctcacctatgggat
ggcaatcccccaatggctcctcccaatcctcgctatagctacaatgtccaggaactaagg
aatgaaattctttcaactgcccagcaggaatctaggggaaggatcttgaaaatatcagat
ttcaaattcagagttcaagatttgtggaaagcccttgtcagtgaaaacttcattttcagt
ttcaggaacacccaagaggtcatagccatgagcaaactggaaacaaagtataatgaatgg
acctgggagctaaggagtcatgtactggacttacagaatcagcttgacaatcagattcaa
aatggaaaaatcctgacactcacatctaatttactagaggaaccacttagcaggaaactt
aaaaccatcaaagaagaatttgacaaatattttgaagaagacccagattgtgaaatattg
gttcagtggaaagcaaattttgaacacaagttactaatccttaaagattcacttatttca
gacaccagacagaaatgcaatgaacatatcagtcttaaaaatagccaagaaatacttgat
aaccaaaagtcacaatatgaaaatcagttgttagagaggagcagaaagttagctttaaat
ttgaagggtaaggaattaagtgatgaagagttgcatgagaaattcaggcaactttggaca
agttggatttatgatgtatcttccaatgttcctcatgtcacagagcctaacattgatttg
gactctgaaaatatccttctggaatatttcaagaaggacaaaaatattgtggaaagacta
aaaataaagtctcaaggaaagtttgaaatcatgtatgacaaacatattcaaatgaaaaag
aaataccttttacttagaaagagtttagaaacctgtcatgttgaatccatcaaaaagaca
accaacaacattcagttaaaatttacagaaacacttacaaacatttggaaacaaaagcgt
gattacagtcagaattactttcatgaaatcttgaggatcatagaaaatgagctgaaatct
gaaccctgtgagggagactacacatttaccaaagactacatcattgacttatccttgtac
ttattccaaagagcatccaaggatttcaagaaaatgcacgcggcattcaagactgcaaat
gaccctgtgaactatctggagagaaagaaagatgatttctttatgagttttaagatctcc
tgccaaggtgccacttcaatcacttcctttgttgacttcctatggctcaagctcactcct
gctatctctgtcagcatatggaaaataatggttcaaaaaatagctggagacatgcgagcc
acctgccctgaattcaatggaaacagagctaacctggagatacatattctctactctcta
gcagaagaagaaaaatttgataaatactggaaatacattcaaaagccagaggaatttttc
agggattatattagagaccacattaaaagatactgttcagaaaaagagagtgaaaaaata
aaaacttttttaaacataagcttaggtgacatcaagaatactatcctgtctgccattcat
aactccacaaaggtagctaaagctaaaggcagcactgcatctcactggctggatttgttc
tgtgaccacctagggagcaacctggtcttcccaaggaaagacctggtaagcatagagcac
caggagctaatggatactgagttcctcaaagaagccatgagcaaagctttggatcctgca
atgagggaagtagaagaggattgttcaagtaagcacatagatgaaattgttcctgacatt
gagaaaattctctctgaacatctctgtggctgttggaaacagtgtcctttttgtaaggca
atttgtacaaacaccattccccagcatgaaggagaccacagtgtgccattccaccgtcct
caggctgtcagtggttggcattggcataaaacagaccagttccacattaatgtttgtact
agtagtgtagcaagtaatatttccttcattttagatggcttccgggaattcccactcaag
aaatatcgagaagcaggaggtgattatgccacatggagcatcaccccagactcatctacc
cagccatattggaaatggtttgtctgtcatttcagatcaaacctagaagagaattatggc
aaaaaatttacagggaaaggtagtcttccagatttatggaccaaaatcacaaagcaagaa
gtcctgaatgacttaaaaaaataa

DBGET integrated database retrieval system