KEGG   Mus musculus (mouse): 74589
Entry
74589             CDS       T01002                                 

Gene name
Kbtbd12, 4833415F11Rik, 4933428M03Rik, Klhdc6
Definition
(RefSeq) kelch repeat and BTB (POZ) domain containing 12
  KO
K21912  kelch repeat and BTB domain-containing protein 12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    74589 (Kbtbd12)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     74589 (Kbtbd12)
SSDB
Motif
Pfam: Kelch_1 BACK BTB Kelch_6 Kelch_2 Kelch_5 Kelch_4 Kelch_3 DUF3342
Other DBs
NCBI-GeneID: 74589
NCBI-ProteinID: NP_001265600
MGI: 1918481
Ensembl: ENSMUSG00000033182
Vega: OTTMUSG00000027855
UniProt: Q9D618
Position
6; 6 D1
AA seq 625 aa
MECKTKGKHQHSLNLLDKIKNMKELEEMIDVVLIAEEEKFPCHRLVLAAFSPYFKAMFTC
GLLECTQREVILYDITAESVSVILNYMYSAVLEINNANVQTVAMAAYFMQMEEVFSVCQN
YMMDHMDASNCIGIYYFAKQIGAEDLSDQSKKYLYQHFAEVSLHGEILDIEAHQLLALIK
SDDLNISREESILDLVLRWVNHNQALRTEHLVELLKQVRLELINASFLRQALRRNTMLLC
DGSCIDIIQNAFKAIKTPQQHPSNLRYGMETTSLLLCIGNNSSGIRSRHRSYGDASFCYD
PVSHKTYFISSPKYGEGLGTVCTGVVMENNTVIVAGEATATRLSRQKSKNIEIYRYHDRG
NQFWEKLCTAEFRELYALGSIHNDLYVIGGQMKIKNQYLITNCVDKYSVDQDNWKRVSPL
PLQLACHAVVTVNNKLYVIGGWTPQMDLPDEEPDRLSNKLLQYDPSQDQWRERAPMRYSK
YRFSAAVVNSEIYVLGGIGCVGRDKGQVRKCLDVVEIYNPDGDFWREGPPMPSPLLSLRT
NSTSAGAVDGKLYVCGGFHGADRHEVISKEILELDPWENQWNVVAINVLMHDSYDVCLVA
RMNPRDLIPPPSDLIEEDGDHRGQR
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggagtgcaagactaaggggaaacaccagcatagcttgaacttactagataaaattaag
aatatgaaagagttagaagaaatgattgatgtagtgctcatagcagaagaggagaaattc
ccttgccacagactggtgctcgctgcctttagtccttatttcaaggctatgttcacctgt
ggactactcgagtgcactcagagagaggtcatactctatgacatcacagcagaaagtgtg
tcagtgatattaaactacatgtacagtgctgtcctggagatcaataacgccaacgttcag
accgtagccatggctgcctattttatgcagatggaagaagtctttagtgtgtgccaaaac
tatatgatggaccacatggatgcctccaactgcataggaatttattactttgcaaaacaa
atcggagcagaagatttatcggatcagtcgaagaagtatttataccagcacttcgccgag
gtaagccttcatggagaaatacttgacatcgaagctcaccagcttctggcacttattaag
tctgatgatctgaatatatccagagaagagagcattctggatttggttctgagatgggta
aaccataaccaagctttgcgcacagagcatctcgttgagcttttgaagcaagtcagactg
gaacttataaacgcttcctttctaagacaggccctcagaaggaacacgatgctcctttgt
gatggcagttgcattgatataatccagaatgcgttcaaagccatcaagacaccccagcag
cacccctccaaccttcgctatggcatggagaccaccagccttctgctttgcattgggaac
aattcttctggaatcagatcaaggcacaggagctatggggatgccagtttttgttatgac
cctgtgtcacacaagacctattttatctcatcacccaagtatggggagggtttgggaact
gtgtgcactggggtagtcatggaaaacaatactgtaattgtggctggagaagcaactgcc
actaggctctctaggcaaaagagcaagaatattgaaatctataggtatcatgatagagga
aaccagttttgggaaaagttatgcacagctgaatttcgagagctctatgctctgggcagc
atccataatgacctctatgtcataggaggacagatgaaaattaaaaaccagtacctcata
acaaactgtgttgataagtactcagtagatcaagacaactggaaacgagtatctcccctt
ccactgcagctggcttgtcatgctgtggtaacagtgaacaataaactgtatgtcatcgga
ggctggacccctcagatggatcttcctgacgaagagcctgatcgattaagcaacaaactg
ttgcagtatgaccccagccaagatcaatggagagagcgggcacccatgcggtactctaag
taccgattcagtgcagccgtcgtcaacagtgagatctatgttctgggtggaattggctgt
gtgggccgagacaagggacaagttcggaaatgccttgatgtggtggagatctacaacccc
gatggggacttctggagggaaggcccgcctatgccgagtcccctcctctcactgcgaacc
aattccaccagtgctggcgccgtggacgggaagctctatgtctgcggtggatttcatgga
gcagatcgacatgaggttatctccaaagagattctggagctggacccttgggagaaccag
tggaacgttgtggccatcaatgtcctcatgcacgacagctatgacgtctgtctggtagct
aggatgaacccccgagacctcatcccaccaccctctgatctgatcgaggaagatggtgac
cacagagggcaaagatga

DBGET integrated database retrieval system