KEGG   Mus musculus (mouse): 74591Help
Entry
74591             CDS       T01002                                 

Gene name
Abca12, 4832428G11Rik, 4833417A11Rik
Definition
(RefSeq) ATP-binding cassette, sub-family A (ABC1), member 12
  KO
K05646  ATP-binding cassette, subfamily A (ABC1), member 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    74591 (Abca12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    74591 (Abca12)
Transporters [BR:mmu02000]
 ABC Transporters, Eukaryotic Type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    74591 (Abca12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC2_membrane_3 AAA_21 AAA_15 AAA_23 Rad17 DUF4162
Motif
Other DBs
NCBI-GeneID: 74591
NCBI-ProteinID: NP_780419
MGI: 2676312
Ensembl: ENSMUSG00000050296
Vega: OTTMUSG00000048805
UniProt: E9Q876
Position
1; 1 C3
AA seq 2595 aa AA seqDB search
MASQFHQLRILVWKNWLGVKRQPLWTLVLILWPVIIFIILAITRTKFPPTAKPTCYLAPR
NLPSAGFFPFLQTLLCDTDSKCKDTPYGPRDLLRRKGIDGPLFKESEILKKPSNPKRDSN
LSLRSTQVPERSHTSLATVPPRPSYDLEGTGTENFNGSQLLTRILGLEKLLKQNSTPEDI
RRELCESYPGYTADYAFSWVTLGKNVFNKFCLSNMTLLESSLQELKYQVSQMSSDPDNQK
RVFRGLVQVLSFFSQVQQQREVWQLLSSLPDVFQNGTSLSSLFGVLQKANRVLLVVQKVY
PRVQTDEGFSTLQKSVKHLLNTLDSPMQGDNSTHAWSDDDEQTLSPSSLAAQLLILENFE
DAILNISSNSPYSPYLACVRNMTDNLAKGSPDNLKLLQSTIHFRKSFLQNGSSEDSFPPF
LEILKSKLSQLRNLTELLCESETFSSIKKSCQFSNMSFERLCEDHAFHVQLIEAAELGTD
LTTGLLYHDNIISAKLRGLLTGDPSKINLNVDWLLEQALQMNYLENITRLIPTVEAMLHV
NTSADASEKPGQLREMFKNIDLLKEDLRAIGMSNTSIDKLLAIPIPDNRAEIISRVFWLH
SCDTNVTNPKLEDAMKEFCKLPLPERSHQSYLIGLTLLHYLDIYNFTYKVFFPRKDQKPM
ERMMELFIKLREILNQLASGTHPLLDKMRSLRQMHLPRSVPLTQAMYRNTRMNSPAGSFS
TISQALCSQGITTEYLTAMLPSSQKPKGNHTKDFLTYKLTKEEIASKYGIPLNATPFCFS
LYKDIINMPAGPVIWAFLKPMLLGKILYSPYNPTTKAIMEKSNVTLRQLAELREKSQEWM
DKSPIFMNSFHLLNQTIPMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDDLDVLRLKLVN
NIDIIDQLNTLSSLTVNISSCVLYDRIQASDTVEEMETVAEQLYKSNELFGSVIFKLPSN
GSLHRGFDPEKVSLPPIVRYTIRMSLKTAQTTRSIRTKIWAPGPHNSPSHNQIYGRAFIY
LQDSIERAIIELQTGRNSQEVAVQVQAVPYPCFMKDNFLTSVSYSLPIVLMVAWVVFIAA
FVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESIGFLLVTIAILIVILKFGNILPKTN
GFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYVIAFFPFIVLVTVEDELSYV
IKVFMSLLSPTAFSYASQYIARYEEQGVGLQWENMYKSPVQDDTTSFGWLCCLILADSFI
YFFIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKHEKSNGLMFTNIMMQNTNP
SASKTSPDCAFPSNIEPEPKDLQVGVALHGVTKIYGSKTAVENLNLNFYEGHITSLLGPN
GAGKTTTISMLTGLFGATAGTIFVYGKDIKTDLNTVRKNMGVCMQHDVLFSYLTTKEHLL
LYGSIKVPHWTKTQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVV
ILDEPSTGVDPCSRRSIWDVISKNKTARTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGS
PFYLKEAFGDGYHLTLTKKKSPNLDTNAICDTVAVTAMIQSHLPEAYLKEDIGGELVYVL
PPFSTKVSGAYLSLLRALDKGMGKLNIGCYGISDTTVEEVFLNLTKDSQKSSNMSLEHLT
QRKVGNPSANGTSTPDDLSVSSSNFTDRDDKVLTRSEKLEGFGLLLKKIMAILIKRFHHT
RRNWKGLIAQVILPIVFVATAMGLGTLRDSSNSYPEIMISPSIYGTSEQTAFYANFDPST
SGLVSALWNFPGIDNVCLNTSDLQCLKKDDLGKWNTSGEAIDNFGVCSCSDNVQECPKFN
YHPPHRRTYSSQVIYNLTGKHMENYLITTANHFVQKRYGGWSFGMKLTNDLRFDVTAVPD
NRTLAKVWYDPEGYHSLPAYLNSLNNFLLRVNMSEYDAARHGIIMYSHPYPGVQDQEQAT
ISSLIDILVALSILMGYSVTTASFVTYIVREHQTKAKQLQHISGIGVTCYWVTNFIYDMV
FYLVPVAFSIGVIAIFKLPAFYSGNNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFI
TYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELS
QQQAVLDFLKAYGVEYPSETFEMDKLGAMFVALVSQGTMFFLLRLLINEWLIKKLRLFFR
KFTSSPIMETVDEDEDVRAERFRVESGAAEFDLVQLHRLTKTYQLIHKKIIAVNNISLGI
PAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKSGSLGHVDSHSSLVGYCPQED
ALDDLVTVEEHLYFYARVHGIPEKDIKDTVHKLLRRLHLMAYKDRSTSMCSYGTKRKLST
ALALIGKPSILLLDEPSSGMDPKSKRHLWRIISEEVQNKCSVILTSHSMEECEALCTRLA
IMVNGRFQCIGSLQHIKSRFGRGFTVKVHLKNNKVSMETLTKFMQLHFPKTYLKDQHLSM
LEYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKDQKSYENVDTSSQ
GSTISVDSQEDQLDS
NT seq 7788 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccagtttcatcagcttcggatcctggtgtggaaaaattggctaggtgtcaaa
aggcagccgctttggacacttgtcttgatcttatggccagtcattattttcataattctg
gctattacccggacaaaattcccgccaacagcaaaaccaacttgttacctcgcacctcga
aaccttcccagtgctggattcttcccattcctacaaaccctgctctgtgacacagactct
aaatgtaaagacacgccctatggaccacgagatctgctccgcaggaaggggattgatgga
ccgctatttaaagaaagcgaaattctgaaaaagccgtccaacccgaagagggacagcaat
ttatcactccggagcacccaagttccagaaagaagtcacacatcattggccacagtacct
ccaagaccaagctatgatttggaaggaacaggcacagaaaatttcaatggtagccaattg
cttacacgcatccttggtttggaaaagctgctgaagcaaaattcaactccagaagacata
cgaagagagctgtgtgagagctaccctgggtacactgcggactatgccttctcttgggtc
accctaggaaaaaacgtttttaacaaattttgcctttcgaacatgacacttttagagtct
tcactccaggaactaaaatatcaagtctctcagatgtcaagtgaccccgacaatcagaag
agggtgttccggggacttgtccaggtgctgtcctttttctctcaagtgcagcagcaaaga
gaagtgtggcaacttctgtcgagcttaccagatgtgtttcagaatggcacctcattgagc
agtctatttggtgttcttcaaaaggcaaacagggtgctgctggtagtgcagaaggtttac
ccacgtgttcaaactgatgaaggattcagcaccctccagaagtctgttaaacatctgctg
aacactctggactccccaatgcaaggtgacaattcaacgcacgcatggagtgatgatgat
gagcagacactgtccccgagcagtctggctgcacagctcctgatcctggaaaactttgaa
gatgccatcttgaacatatcatcaaatagtccatattctccttatttggcgtgtgtaagg
aacatgactgacaacttggctaagggatcaccagacaatctaaaacttctgcagtccaca
attcacttcagaaaatctttccttcaaaatggctcctccgaggacagcttccctccattt
cttgagatcctgaaatccaagctgtctcaacttcgaaatttgacggaacttctctgcgaa
tcagagactttcagttcgatcaagaagtcttgccagttctctaacatgagcttcgagagg
ctgtgtgaagaccatgcctttcacgtgcaactgattgaagcggcagagctgggcactgac
ctcaccactggcttactgtaccatgacaatataatatctgcaaagctgaggggtttgctc
actggagatcccagcaaaattaatctcaatgtggactggctcctggaacaggcattgcaa
atgaattacttggagaatatcacacggctcataccaaccgtagaggccatgctgcatgtc
aacaccagtgcagacgcttctgagaagccaggtcaattaagagaaatgtttaaaaacata
gatttgctgaaagaagatctgagggcgatagggatgtccaacacaagtatcgacaagctg
ttggccattcccattccagacaatagagccgagataatttctcgtgtattctggttgcac
tcatgtgataccaacgtcaccaaccccaaactggaagatgccatgaaggagttctgcaag
ctgcctcttccagagagatcacatcagtcctacctcatcggactcacccttctgcactac
ttagacatttacaatttcacatacaaggtgtttttcccaaggaaggatcaaaagccaatg
gaaaggatgatggagcttttcataaagctgagagagattctcaatcagttggcttccggc
acacatccactgctggacaaaatgagatccctgagacaaatgcacctgcccaggagtgtt
ccattaacacaggccatgtacagaaacactcgaatgaactcgccagcaggatcgttcagt
actatctcccaggctctgtgctcccaggggatcaccaccgagtacttaactgctatgctg
ccttcttcccagaagccaaaaggcaaccacaccaaggattttctcacttataaattaact
aaagaagaaattgcttcaaaatacgggattcctttaaatgctacaccattttgcttctcc
ctttacaaagacatcattaacatgcctgctgggcctgtgatttgggccttcttgaaaccc
atgttgttgggaaagattttatattcaccatataacccaactacaaaggccattatggaa
aagtccaatgtaactctaagacagctggcggaattaagagaaaaatctcaggagtggatg
gataagtcaccaattttcatgaattccttccacctgctaaaccagacgatcccaatgctc
cagaatactctacggaacccctttgtgcaagtttttgtgaagttctccgtgggactcgat
gctgtcgaactcctgaagcagatagacgaccttgatgttctcaggctgaaattagtgaac
aacattgacatcattgatcagctcaacacactgtcttccctgactgtaaatatttcctcc
tgtgttctttacgaccgtattcaggcgtcagacactgtagaggagatggagacggtggcc
gaacaactctacaagagcaacgagctctttggaagtgtcatttttaagcttccatctaac
ggaagtttgcacagagggtttgaccctgaaaaagtgtctcttcctcctatcgtaagatat
accatccgcatgagtctgaagacggcacagaccacaaggagcataagaacaaagatctgg
gccccagggccacacaactctccatcccataaccagatctatggccgggctttcatttat
ctgcaggatagcattgagagagcaattattgagttacaaacaggaaggaactcacaggaa
gtcgccgtccaggttcaagcggttccttatccctgcttcatgaaggacaatttcctcacc
agtgtctcctattccctcccgattgtgcttatggtcgcctgggttgtatttatagctgcc
tttgttaaaaagctagtctacgagaaggaccttcggctccatgagtacatgaagatgatg
ggtgtcaactcctgcagccatttctttgcctggcttatagagagtattgggttcttgctg
gtcaccattgcaatcctcatcgttatcctcaagtttggcaatattcttcccaagacaaac
ggcttcattttgttcctgtacttctcagactacagcttctcagtgattgccatgagctat
ctcatcagtgtcttcttcaacaacaccaacattgcagctctgattggaagcctcatctat
gtcatcgcctttttcccatttattgttctggttacagttgaggatgagctgagctacgtt
attaaagtattcatgagcctgctgtccccgacagcattcagctatgcaagccaatatatt
gcacggtatgaagaacaaggcgttggtcttcagtgggaaaatatgtacaaatcccctgtt
caggatgacaccacctcatttggctggctgtgctgtctaatcctagcagactccttcatt
tatttctttattgcttggtacgtcaggaatgttttcccagggacatatggaatggcagct
ccatggtattttcccatccttccttcctattggaaagagcgctttggatgcgcagaggtg
aagcatgagaaaagcaatggcttaatgtttactaatatcatgatgcagaacaccaaccct
tctgccagtaagacaagtcctgactgtgcatttccctccaacattgaacctgaacctaaa
gatctccaagttggagttgcccttcatggggtcacaaagatctatggctcaaaaacagct
gttgagaacctcaatctgaacttctacgaagggcacattacatcactgttggggccaaac
ggagctggcaaaaccacaacaatctccatgctgactgggctgtttggtgccacagcgggt
accatttttgtatacggaaaagatatcaagacagacctgaatactgttcggaaaaacatg
ggggtctgcatgcaacatgacgtcttgttcagttacctaaccaccaaggaacaccttctc
ctgtatggctccatcaaagttcctcactggaccaaaacacagctccatgaggaggttaaa
aggactttaaaagacactggactgtatagtcatcgccataagagagttggaacgttgtcg
ggaggaatgaagaggaagttgtccatatccatagctctcatcggtggctccagggtagtg
attttggatgaaccatccacgggcgttgacccatgttctcgccgaagcatatgggatgtc
atatccaagaacaaaactgcaagaacaatcattctgtccacacaccacttggatgaggcc
gaagtgctgagtgaccgcatcgccttcctggaacagggtgggctccggtgctgtggatct
ccattttacctcaaggaagcttttggggatggttaccacctcacactcaccaagaagaag
agtccaaacctagacacaaatgcaatctgtgacacagtggcagtgacagcaatgatccag
tcgcaccttcctgaagcctacctcaaagaggatattgggggagagcttgtatatgtgctc
cctccattcagcacgaaagtctcaggagcttacctgtccctcctgagagcactggacaag
ggcatgggtaaactcaacatcggctgctatggcatttcagacaccactgttgaagaggtc
ttcctgaacttgacaaaagattcgcaaaaaagtagtaatatgagtctggagcacttaaca
cagaggaaagttgggaaccccagtgccaacgggacctccactcctgacgacctgtctgtg
agcagcagcaacttcaccgacagagacgacaaagtcctgacaagaagcgagaagctggag
ggctttggactcttactgaagaagataatggctattctcatcaagaggttccaccacacc
cgccggaactggaaaggtctcattgctcaggtcattctccccatcgtctttgtagccacg
gccatgggtctcggcacactgagagattccagcaacagttacccagagatcatgatctct
ccgtccatttacggcacctccgaacagacagccttctacgcgaattttgatccaagcacc
agtggtctggtctcagctctctggaatttccctggcattgacaatgtgtgtttgaatact
agtgacttgcagtgtttaaaaaaagatgatctgggaaagtggaacacaagtggagaagct
atcgacaactttggtgtttgctcctgttccgacaatgtccaggaatgccccaaattcaac
tatcatccacctcatagaagaacttactcttcccaagttatttataacctcactggaaaa
cacatggaaaattatcttataacaactgcaaatcattttgtgcagaaaagatatggaggt
tggagttttgggatgaaattgactaacgaccttcgttttgatgtgacagctgtccctgac
aatagaactcttgctaaggtgtggtacgatccggaaggctaccattccctcccagcttac
ctcaacagcctcaacaacttcctcctgagggttaacatgtcagagtacgatgctgcccga
cacgggatcatcatgtatagccacccttatccaggggtacaagaccaggaacaagccaca
atcagcagtttaatcgatattttagtggcgctgtccatcctgatgggctactctgtcacc
actgccagctttgtcacctacattgtcagggaacatcagaccaaagccaagcagttgcag
cacatttctggcatcggtgtgacgtgctactgggtgacaaatttcatctatgacatggtc
ttctatttggttcctgtagcattttcaattggtgtcatcgcaattttcaagcttcctgcc
ttctacagtggaaacaatctaggcgctgtatccctcctacttttgctgtttggctatgca
acattttcttggatgtacctgctggctggcctcttccacgaaacaggaatggccttcatc
acttatgtgtgtgtcaacctgttctttggtatcaattccatcgtttccctgtcggtggta
tacttcctttccaaggaaaagcctaatgacccgacgctagaacttatttctgaaactctc
aagcggattttcctgatcttcccccaattctgttttggctacggtttgattgaactttct
cagcaacaggcagtcttggatttcttaaaagcctacggtgtggaatatccaagcgagacc
tttgagatggataagctgggggcaatgtttgtggccttggtttctcagggcaccatgttt
ttcttgttgcgactcctcatcaatgagtggctgataaagaagctcaggctcttcttcagg
aaatttacatcttcgcctatcatggagacagtagatgaagatgaagatgtgcgggctgag
agatttcgagttgagagtggtgcagctgagtttgacctggtccagctccatcgtctcaca
aagacctaccagctgatccacaagaagattatagctgtcaacaacatcagcctggggata
cctgctggagagtgttttggcctccttggtgtgaacggagcagggaaaaccactatattt
aagatgctgactggagacataattccttccagtggaaacattctgatcagaaacaagagc
ggatccctgggacatgtggattctcacagctctttggttggctactgccctcaggaggac
gctttagatgacctagtaactgtggaagagcacttgtatttctatgccagagtgcatggg
attccagagaaggacatcaaagacactgttcataaactccttaggagacttcacttgatg
gcctacaaggacagatctacctccatgtgcagttacggcacaaaaaggaagctgtccact
gccctggccttgatagggaaaccgtccatcctcctgctggatgagccaagctctgggatg
gatcccaagtcaaaacgacacctctggaggatcatttcagaagaggtgcagaacaaatgc
tctgtcatcctcacatctcacagcatggaagaatgtgaagctctttgtacccggctggcc
attatggtgaacggaaggttccagtgcattgggtctctgcaacacataaaaagcaggttt
ggacgtggatttactgtcaaggttcacttgaaaaataataaagtgagcatggaaaccctc
acgaagtttatgcagctacactttccaaaaacatacttaaaagatcagcacctgagcatg
ctggagtaccacgtgccagtcacagcaggaggggtcgcaaacatctttgaccttctggaa
accaacaagactgctttaaatatcacaaatttcctcgtgagccagaccactttggaggag
gttttcatcaactttgccaaagaccaaaaatcctacgaaaatgttgataccagtagccaa
ggttccaccataagtgtagactcacaggaagatcaactagattcttag

DBGET integrated database retrieval system