KEGG   Mus musculus (mouse): 74596Help
Entry
74596             CDS       T01002                                 

Gene name
Cds1, 4833409J18Rik, AI314024, AW125888
Definition
(RefSeq) CDP-diacylglycerol synthase 1
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    74596 (Cds1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    74596 (Cds1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     74596 (Cds1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_1
Motif
Other DBs
NCBI-GeneID: 74596
NCBI-ProteinID: NP_775546
MGI: 1921846
Ensembl: ENSMUSG00000029330
Vega: OTTMUSG00000029627
UniProt: P98191
Position
5; 5 E4
AA seq 461 aa AA seqDB search
MLELRHRGGCPGPGGAGAPPPREGEAAGGDHETESTSDKETDIDDRYGDLDARGDSDVPE
VPPSSDRTPEILKKALSGLSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQV
KCFHEIITIGYRVYHSYDLPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLI
RYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMI
WFLVPISSVICNDITAYLFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSK
YQYFVCPVEYRSDVNSFVTECEPSELFQLQNYSLPPFLQAVLSRETVSLYPFQIHSIALS
TFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRG
PNPSKVLQQLLVLQPEQQLNIYRTLKIHLTEKGILQPTLKV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgctggagctgcggcaccgcgggggctgccccggccctgggggagcgggggcgccgcca
ccccgcgagggagaggcggccggcggtgaccacgaaaccgagagcaccagcgacaaagaa
acagatattgatgacaggtatggagatctcgatgccagaggcgattccgacgtgcctgag
gtcccaccgtcctcagacaggacccccgagattctcaagaaagccctgtccggactatct
tcaagatggaagaactggtggattcgcgggatcctcaccctcaccatgatctccctcttc
ttcctgattatctatatggggtccttcatgctgatgcttctggttctgggcatccaagtg
aagtgcttccatgagatcatcaccatcgggtaccgggtctaccactcctacgacctccca
tggtttaggacactaagttggtacttcctcctgtgtgtgaactacttcttctatggagag
acggtggcagattacttcgccacgtttgttcagagggaggagcagctgcagttcctcatt
cgctaccacaggttcatatccttcgccctctacctggcaggtttctgcatgtttgtcctg
agcctggtgaagaagcactacagactgcagttctatatgttcgcatggacgcacgtcact
ttactgataaccgtcactcagtcacatcttgtcatccaaaatctgtttgaaggcatgata
tggttccttgttcccatatcaagcgtcatctgcaatgacatcacagcttatctttttgga
tttttttttggaagaactcctctaattaagctgtctcctaagaagacttgggaaggattc
attggtggtttcttctccacagtcatatttggattcattgctgcctatgtgttgtccaag
taccagtactttgtgtgcccggtggaataccgaagcgacgtcaactccttcgtgacagag
tgtgagccctcagaactgttccagcttcagaattactccctccctccattcctacaggca
gtgctgagccgggagactgtgagcttgtaccccttccagatacacagcattgccctttca
acgttcgcgtcactgattggcccatttggaggcttctttgccagtggattcaaaagagct
ttcaaaatcaaggattttgcaaacacgattcctggacatggcgggataatggacaggttt
gactgtcagtatttgatggcaacgttcgtgcacgtgtacatcaccagcttcatcaggggt
ccgaatcccagcaaagtgctccagcagctgttagtgcttcaaccagaacagcagttaaat
atctacagaaccctgaagattcatctcaccgagaaagggatcctgcagcccaccttgaag
gtgtag

DBGET integrated database retrieval system