KEGG   Mus musculus (house mouse): 74646
Entry
74646             CDS       T01002                                 
Symbol
Spsb1, 1110014L01Rik, 4930422J18Rik, AI596360, AI854583, SSB-1, SSB1
Name
(RefSeq) splA/ryanodine receptor domain and SOCS box containing 1
  KO
K10343  SPRY domain-containing SOCS box protein 1/4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    74646 (Spsb1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     74646 (Spsb1)
SSDB
Motif
Pfam: SPRY SOCS_box
Other DBs
NCBI-GeneID: 74646
NCBI-ProteinID: NP_083311
MGI: 1921896
Ensembl: ENSMUSG00000039911
UniProt: Q9D5L7
Position
4:complement(149980740..150039463)
AA seq 273 aa
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRSVRLALGKERLGAIPALPLPASLKAYLLYQ
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggtcagaaggtcacaggagggatcaagactgtggacatgcgggaccccacataccga
cctctgaagcaggaactccaggggctggattactgcaagcccacccggctggacctgctg
ctcgacatgccccctgtgtcctacgatgtgcagctgctccactcctggaacaataacgac
cgttcgctcaacgtcttcgtgaaggaagatgacaagttgatctttcaccggcatccggtg
gcccagagcacggacgccatcaggggcaaagttgggtacacacgtggactgcatgtatgg
cagatcacatgggccatgaggcaacgaggcacgcatgccgtggtgggggtggccacagca
gatgcccctttgcactccgttgggtacacaacccttgtaggaaataaccatgaatcctgg
ggctgggacctggggcgtaaccgtctctaccacgacggcaagaaccagccaagtaaaaca
tacccagcctttctggagccggacgagacattcattgtccctgactcctttctcgtggcc
ctggacatggatgatgggaccttaagtttcatcgtggatggacagtacatgggagtggct
ttccggggactcaagggtaaaaagctgtatcctgtagtgagtgccgtctggggccactgt
gagatccgcatgcgctacttgaacggacttgatcctgagcccctgccactcatggacctg
tgccggcgttcggtgcgcctagcgctgggaaaggagcgcctgggtgccatccccgctctg
ccgctacctgcctccctcaaagcctacctcctctaccagtga

DBGET integrated database retrieval system