KEGG   Mus musculus (mouse): 74648
Entry
74648             CDS       T01002                                 

Symbol
S100pbp, 4930429A08Rik, AI851343, S100pbpr
Name
(RefSeq) S100P binding protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: S100PBPR
Other DBs
NCBI-GeneID: 74648
NCBI-ProteinID: NP_083312
MGI: 1921898
Ensembl: ENSMUSG00000040928
Vega: OTTMUSG00000009625
UniProt: Q9D5K4
Position
4; 4 D2.2
AA seq 396 aa
MTCSLLPSEQSSGASFLPKSNASFPWGSLDEDELDDSLLEFSDGEEDDGHFSFTEEEIEM
LLKDDDGGHNEYRPRKSQILPDIPQENSLYSLGPAAETPGFLKLPQLSTSVGHGPTPSKS
LNRHFVLEKNLIKVTVVAPFNPTVCDPVLDKDKIDSSKETENPASLREQTREDDPQPNES
KRCTEPEGVSPNTSAWDGPLLSSPSNNNIEQTASDKNIPESKKPTPVFSQISNHSEVPNR
KNSGSHKSGCEVRIPVVSSSSNRHAFDKDSGEAKGERRLGKVIPVLQTRTRMFSQSELEK
QKDIYLSKVIAHIEDPGDSNQGTLGELDALMDQVHMQHPDWQHPSDLTTRNYARFRQRPL
QRYSLSQWVDRNKRSHHRFQRLPDFSYSPYVSSHQQ
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgacgtgttcactcttgccctctgaacagtcttctggtgcctcttttctgcctaaaagc
aatgcctcatttccttggggttccttggatgaagatgagttggatgactccttgttggag
ttttctgatggagaagaagatgatggccatttcagtttcacagaggaagagattgagatg
ctcttgaaggacgatgatggtgggcataatgagtatagaccaagaaagagtcaaattcta
cctgatattcctcaagaaaattctttgtacagcttgggaccagcagctgaaacccctggc
ttcctaaaactacctcaactaagtacatcagttggtcatggacctactcctagtaaatca
ttaaacagacactttgtacttgaaaagaatcttataaaagtaactgttgtcgcaccattt
aatccaacagtttgtgatcctgtgcttgataaagacaagatcgattcctccaaagaaacg
gaaaatcctgcctcccttcgggaacagacgagagaagatgaccctcaacctaatgagagt
aaacgttgcactgagcctgaaggggtcagtcccaatacctctgcttgggatgggcccctg
ctttcttctccttcaaacaataacatcgaacaaactgcctctgataaaaatatacctgaa
agtaagaaacctacccctgtgttctctcagatctccaaccattcagaggtccccaacagg
aaaaacagtggctcacataaatcaggttgtgaagtgagaattccagttgtgtccagttca
tcaaacagacatgcctttgacaaggattctggggaggcgaaaggtgagagaagactaggc
aaagtcattcctgttctacaaactagaaccaggatgttttcacaatcagagctagaaaaa
cagaaggacatttatctcagcaaagtcattgctcatatagaagatccaggggactctaac
caaggtaccttgggagagctagatgccctgatggatcaagttcatatgcagcacccagac
tggcagcatccttcagatcttaccacacgaaactacgcccggttccgacagaggcctctg
cagaggtacagtctgagtcagtgggttgacagaaacaagcggagccaccatcggttccag
cgtctcccagacttctcctacagtccatatgtctcatcccatcaacagtga

DBGET integrated database retrieval system