KEGG   Mus musculus (house mouse): 74666
Entry
74666             CDS       T01002                                 
Symbol
Brme1, 4930432K21Rik, MRM, Mamerr, Meiok21
Name
(RefSeq) break repair meiotic recombinase recruitment factor 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Brme1
Other DBs
NCBI-GeneID: 74666
NCBI-ProteinID: NP_083321
MGI: 1921916
Ensembl: ENSMUSG00000008129
UniProt: Q6DIA7
Position
8:84874637..84899226
AA seq 600 aa
MNKKKQRNSGVGLHPSKPSKNPRLRDSQSSMMVHSHYSRESEDSSEPAPSVELGGEEPLH
EAFSCPVEDTGAASDLAGSPKELVPLPPSQNSVGKFVPQFAKPRKTVTRKAKAWEEDLEG
CTTSQETRPELGALKAASQPQRESLRFPPHDIRPEVQTQPDGTLSKERTISLDNRSLGNN
GFEMATVQDSSSPLSDAAAEGREADSRDPQERDAQGGEAGAQHSGEPQEGEDILYTSALA
PASEPTWSVAQDLSVPTYTLSSTAAAPSSTSPADASLMDTVITEVSLDPSVLQQSAPQVA
KLLGSLDEQIPDGGCIGTLLSSTPLAEETTAGREEARWEERCHGDTLASFTETEPEKQEP
VTEAGDSGHIAQEMDPVVKTKDSGSDEQSPGDIGMLPLPAQSMNQMLVELRGLTCDQDLE
GLSTPHTSSQLEHTCAASDPPQSTKDCHSSPGIPVHLAAPCPRDQAAWQESSAMELDFLP
DSQIQDALDATNMEQGFPSGSMPDLGWPVPSSQSIGGSPKAVTKPQSRSHVETWAQETYR
MQDATDTVRGLVVELSGLNRLIMSTHRDLEAFKRRKTKSLPYLTKGLGSLPRGDQSWRDL
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgaataagaagaaacagcggaactcaggggtcggcctccatccctcaaagccttctaag
aacccacggctgagagactcccagagctccatgatggtccattcacactactccagagag
tcggaagacagctcagaacctgctccttctgtagagctaggcggggaggaaccactacac
gaagctttcagctgcccagtggaggacacaggagctgcctctgacctcgcaggatcaccc
aaagagctggtccccctgcctccttcccagaactcagttgggaagtttgtccctcagttt
gccaaaccaagaaagacagtaactagaaaagccaaggcatgggaagaggatctagagggc
tgcaccacaagccaggaaacaaggccagagctgggagccctcaaagcagccagccagcca
cagagagagtccctgaggttccctccccatgacatcagaccagaagtccagacacagcca
gatggaaccctttcaaaggagaggacaatctcactagataatagaagcctggggaacaat
ggttttgagatggccacagttcaagacagtagtagccccctgtcagatgctgctgctgaa
ggcagggaggcagacagcagagacccacaggaaagagatgcccaaggaggggaagcaggg
gcccagcattctggggaaccccaggaaggagaggacatcctctacacatcagcattagct
cctgcctcagagcccacctggtctgtggctcaagacctctctgtccccacatatactctc
agcagcacagctgcagcacccagctccaccagcccagcagatgcctctcttatggacact
gtcattacagaagtgagcttagatccctctgtgctgcaacagagtgctccacaggtggcc
aagctgctgggctctctggatgagcagatccctgatggaggctgcattggaactctgctg
agctccacacctcttgctgaggagaccacagcaggcagagaggaggccagatgggaagag
aggtgtcatggtgataccctggcaagcttcactgagacagagcctgagaaacaagagccc
gtgacggaagctggagattccggccatatagcccaagaaatggatccagtggtcaagacc
aaggactctggctctgatgagcagtcgccaggagatataggaatgctgcctttaccagca
cagtccatgaatcagatgttggtagagttacgtggcctaacttgtgatcaagacttagag
ggcctcagtacccctcatacctcctctcagctagagcacacttgtgcagctagtgaccct
ccccagagcaccaaggactgtcacagcagcccaggcattcctgtacacctggcagctccc
tgtcccagagaccaggctgcatggcaggagtcctcagcaatggaactagacttcctgcct
gacagccagatacaggatgccctggatgccactaacatggagcagggttttccttcaggg
agtatgccagaccttggctggcctgtccctagctcacagtccatcggaggatccccaaag
gcagtcaccaaacctcaatccagatcccatgtggaaacctgggcccaggagacctacagg
atgcaggatgcaacagacacagtgcgaggcctcgtggtggagctctccggtctgaaccgg
ctgattatgagtacccaccgggacctggaggccttcaagcgcaggaagaccaagtctctg
ccttacctgacaaaggggttggggagccttcctagaggggatcagagctggagggacttg
taa

DBGET integrated database retrieval system