KEGG   Mus musculus (mouse): 74666Help
Entry
74666             CDS       T01002                                 

Gene name
4930432K21Rik
Definition
(RefSeq) RIKEN cDNA 4930432K21 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4671
Motif
Other DBs
NCBI-GeneID: 74666
NCBI-ProteinID: NP_083321
MGI: 1921916
Ensembl: ENSMUSG00000008129
Vega: OTTMUSG00000030573
UniProt: Q6DIA7 E9QNR8
Position
8; 8 C2
AA seq 600 aa AA seqDB search
MNKKKQRNSGVGLHPSKPSKNPRLRDSQSSMMVHSHYSRESEDSSEPAPSVELGGEEPLH
EAFSCPVEDTGAASDLAGSPKELVPLPPSQNSVGKFVPQFAKPRKTVTRKAKAWEEDLEG
CTTSQETRPELGALKAASQPQRESLRFPPHDIRPEVQTQPDGTLSKERTISLDNRSLGNN
GFEMATVQDSSSPLSDAAAEGREADSRDPQERDAQGGEAGAQHSGEPQEGEDILYTSALA
PASEPTWSVAQDLSVPTYTLSSTAAAPSSTSPADASLMDTVITEVSLDPSVLQQSAPQVA
KLLGSLDEQIPDGGCIGTLLSSTPLAEETTAGREEARWEERCHGDTLASFTETEPEKQEP
VTEAGDSGHIAQEMDPVVKTKDSGSDEQSPGDIGMLPLPAQSMNQMLVELRGLTCDQDLE
GLSTPHTSSQLEHTCAASDPPQSTKDCHSSPGIPVHLAAPCPRDQAAWQESSAMELDFLP
DSQIQDALDATNMEQGFPSGSMPDLGWPVPSSQSIGGSPKAVTKPQSRSHVETWAQETYR
MQDATDTVRGLVVELSGLNRLIMSTHRDLEAFKRRKTKSLPYLTKGLGSLPRGDQSWRDL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaagaaacagcggaactcaggggtcggcctccatccctcaaagccttctaag
aacccacggctgagagactcccagagctccatgatggtccattcacactactccagagag
tcggaagacagctcagaacctgctccttctgtagagctaggcggggaggaaccactacac
gaagctttcagctgcccagtggaggacacaggagctgcctctgacctcgcaggatcaccc
aaagagctggtccccctgcctccttcccagaactcagttgggaagtttgtccctcagttt
gccaaaccaagaaagacagtaactagaaaagccaaggcatgggaagaggatctagagggc
tgcaccacaagccaggaaacaaggccagagctgggagccctcaaagcagccagccagcca
cagagagagtccctgaggttccctccccatgacatcagaccagaagtccagacacagcca
gatggaaccctttcaaaggagaggacaatctcactagataatagaagcctggggaacaat
ggttttgagatggccacagttcaagacagtagtagccccctgtcagatgctgctgctgaa
ggcagggaggcagacagcagagacccacaggaaagagatgcccaaggaggggaagcaggg
gcccagcattctggggaaccccaggaaggagaggacatcctctacacatcagcattagct
cctgcctcagagcccacctggtctgtggctcaagacctctctgtccccacatatactctc
agcagcacagctgcagcacccagctccaccagcccagcagatgcctctcttatggacact
gtcattacagaagtgagcttagatccctctgtgctgcaacagagtgctccacaggtggcc
aagctgctgggctctctggatgagcagatccctgatggaggctgcattggaactctgctg
agctccacacctcttgctgaggagaccacagcaggcagagaggaggccagatgggaagag
aggtgtcatggtgataccctggcaagcttcactgagacagagcctgagaaacaagagccc
gtgacggaagctggagattccggccatatagcccaagaaatggatccagtggtcaagacc
aaggactctggctctgatgagcagtcgccaggagatataggaatgctgcctttaccagca
cagtccatgaatcagatgttggtagagttacgtggcctaacttgtgatcaagacttagag
ggcctcagtacccctcatacctcctctcagctagagcacacttgtgcagctagtgaccct
ccccagagcaccaaggactgtcacagcagcccaggcattcctgtacacctggcagctccc
tgtcccagagaccaggctgcatggcaggagtcctcagcaatggaactagacttcctgcct
gacagccagatacaggatgccctggatgccactaacatggagcagggttttccttcaggg
agtatgccagaccttggctggcctgtccctagctcacagtccatcggaggatccccaaag
gcagtcaccaaacctcaatccagatcccatgtggaaacctgggcccaggagacctacagg
atgcaggatgcaacagacacagtgcgaggcctcgtggtggagctctccggtctgaaccgg
ctgattatgagtacccaccgggacctggaggccttcaagcgcaggaagaccaagtctctg
ccttacctgacaaaggggttggggagccttcctagaggggatcagagctggagggacttg
taa

DBGET integrated database retrieval system