KEGG   Mus musculus (house mouse): 74685
Entry
74685             CDS       T01002                                 
Symbol
Lrrc74b, 4930451C15Rik, mCG12354, mCP17390
Name
(RefSeq) leucine rich repeat containing 74B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: LRR_6 LRR_1 LRR_8 LRR_4
Other DBs
NCBI-GeneID: 74685
NCBI-ProteinID: NP_083329
MGI: 1921935
Ensembl: ENSMUSG00000022759
UniProt: Q14BP6
Position
16:complement(17362329..17379159)
AA seq 391 aa
MKGPCEVQKNEDQEGEAAATGPQAETLEAERSWTADSHSALEAEGTHGLGERVMATLYLK
SCRANSVVPVSCLLRQEGASELNLRHRGLGPQGVRALASVLTSNPYIKRLDLRDNGLCGA
GAEALADVLRKNSIISDVDLSENQIGAAGLQAICTALALNPTVEKMQLQGNRLEEQAAQH
LAALLLHHRGLKSLDLSYNQLNDLAGEILGPAVAENTGLTELNLSWNHLRGLGATAFARG
LEANIFLKVLDISHNGFGDSGASAIGDALRVNNVLEELNMRNNRISVSGALKLGLGLQVN
QTLRILIISKNPIRSDGCVGLLKSVRNNKSSALELLDVSDIQVSRECEDLASSMSEILPG
LCIKRYTSRRKDWPQASTPSQPASAPSDSGL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaagggtccctgcgaagttcagaagaatgaagatcaagagggagaagctgcggccact
gggcctcaggcagagaccctggaggccgaaaggtcctggactgcagattcacactctgct
ctggaagcagaaggcacccatgggcttggagaacgggtcatggctaccctctatctgaag
tcttgccgggccaatagtgttgtgccagtttcttgtcttctgcgccaagagggtgcctct
gaattgaaccttcggcaccgtggcctggggccccagggggtccgggcattggcttccgta
ttgacctctaatccctacatcaagcgtctggatcttcgggacaatgggctctgtggtgct
ggagcagaggctctggctgatgtcctgcgtaagaacagcattatctctgatgtggacctg
tcagagaatcagattggagctgcagggctccaggcgatctgcactgcccttgccttaaac
ccaactgttgagaagatgcagctgcaagggaacaggctggaggaacaagcagcccagcac
ctcgctgctcttctgctgcatcacaggggcctgaaatctctagacctcagctataatcag
ctcaatgacctggcaggagagatacttggacctgctgtggcagaaaacacaggactcaca
gagcttaacctcagttggaatcacctgcgaggtctgggagccaccgcgtttgcccgaggc
ctggaggcaaatatattcttgaaagtcctagacatctctcataatggctttggagactct
ggtgccagtgcgattggtgatgccctcagggtcaacaatgttttagaagaactgaatatg
aggaacaaccgaatctccgtgtcaggagccctgaagttgggattgggtctgcaagtcaat
cagacgctgcggattcttattatttccaagaatcctattcgcagtgacggctgtgttggc
ctccttaagtctgtccggaacaacaaatcatctgccctagaactgctggatgtgtctgat
atccaagtaagcagagaatgtgaggacctcgctagctccatgagtgaaattcttccagga
ctctgtataaagcgttatacttctagaagaaaagactggccacaagcctctacaccatcc
cagccagcatctgcaccaagtgactctggtctctaa

DBGET integrated database retrieval system