KEGG   Mus musculus (mouse): 74711
Entry
74711             CDS       T01002                                 

Symbol
Ttll9, 1700016F23Rik, 4930509O20Rik, AW046572
Name
(RefSeq) tubulin tyrosine ligase-like family, member 9
  KO
K16603  tubulin polyglutamylase TTLL9 [EC:6.-.-.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    74711 (Ttll9)
Enzymes [BR:mmu01000]
 6. Ligases
  6.-  
   6.-.-  
    6.-.-.-  
     74711 (Ttll9)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Tubulin modification proteins
     Tubulin polyglutamylases
      74711 (Ttll9)
SSDB
Motif
Pfam: TTL ATPgrasp_YheCD ATPgrasp_ST DUF3211 RimK T4SS_TraI
Other DBs
NCBI-GeneID: 74711
NCBI-ProteinID: NP_001077087
MGI: 1913589
Ensembl: ENSMUSG00000074673
Vega: OTTMUSG00000015923
UniProt: A2APC3
Position
2; 2 H1
AA seq 461 aa
MSRQKNQNSKGHGVSKGKEREQRTLIRFKTTLMNTLMDVLRHRPGWVEVKDEGEWDFYWC
DVSWLRENFDHTYMDEHVRISHFRNHYELTRKNYMVKNLKRFRKYLERESGKTEAAKCDF
FPKTFEMPCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFRRLKDIMDWRKGTSGKKP
TGVETQPARANMNPSGSHDTRSSDDQKDDLPVENYVAQRYVENPYLIGGRKFDLRVYVLV
MSYIPLRAWLYRDGFARFSNTRFTLNSIDDHYVHLTNVAVQKTSPDYHLKKGCKWMLQRF
RQYLASKHGPKAVETLFSDMDNIFIKSLQSVQKVIISDKHCFELYGYDILIDQDLKPWLL
EVNASPSLTASSQEDYELKTCLLEDTLHVVDMEARLTGKEKRVGGFDLMWNDGPVSREDG
PSDLSGMGNFVTNTHLGCVNDRKEQLRQLFRSLQAQRKAPS
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtcgcgacagaagaatcaaaattccaagggccatggagtgtcgaaaggaaaagagaga
gagcagagaaccttaatccgcttcaagaccaccctcatgaacacactcatggatgttctg
cgccacaggcccggatgggtggaagtcaaagatgaaggcgaatgggatttctattggtgt
gatgtcagctggctgcgggagaactttgaccacacctacatggatgagcacgtgcgcata
agccacttccggaaccactacgagcttaccaggaaaaactacatggtaaagaacctgaag
cgcttccggaagtacctggagcgtgagtcaggaaagacggaggcagccaagtgtgacttc
ttccccaaaacctttgagatgccctgtgagtaccatctgtttgtggaggagtttcgcaag
aaccccgggatcacctggatcatgaagcctgtcgcccgatctcaggggaagggcatattt
ctcttccggagactgaaagacatcatggactggaggaagggcacttcggggaagaaaccc
accggtgtggagacgcagcctgctcgagccaacatgaacccctcaggcagccatgacaca
aggagttctgatgaccagaaagatgacctcccggtggagaactacgtggctcagcgttac
gtggaaaacccctacttaataggaggccgcaagtttgacctgcgcgtctacgtgctggtg
atgtcgtacatccctctgcgggcatggctgtaccgtgatggctttgccaggttctccaac
acccgattcacactgaatagcatcgatgaccactatgttcacctcaccaatgttgctgtg
cagaagacatcgcctgactaccacctaaaaaagggttgcaagtggatgcttcagcgcttc
aggcagtacctggcttccaagcatggtcctaaggccgtggagacactcttcagtgacatg
gacaatatcttcatcaagagcctgcagagcgtgcagaaggtgatcatcagtgataagcac
tgctttgagctctatggctatgacatcctcattgaccaggacctcaagccgtggctccta
gaagtcaatgcctctccttccctgacggccagcagccaggaggactatgaactcaagacc
tgtctgctggaggataccctgcacgtggtggacatggaggccaggctcacaggaaaggag
aagagagtcgggggcttcgatctcatgtggaatgatggccctgtcagccgagaggatggg
ccttctgacctatcagggatggggaactttgtgaccaacactcacctaggctgcgtcaat
gaccggaaggagcagctcaggcagctgttccgatcccttcaagcgcagaggaaagcccct
agctga

DBGET integrated database retrieval system