KEGG   Mus musculus (mouse): 74732Help
Entry
74732             CDS       T01002                                 

Gene name
Stx11, 5830405C08Rik
Definition
(RefSeq) syntaxin 11
  KO
K08487  syntaxin 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    74732 (Stx11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74732 (Stx11)
Membrane trafficking [BR:mmu04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    74732 (Stx11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin SNARE DUF1217 Nucleoplasmin
Motif
Other DBs
NCBI-GeneID: 74732
NCBI-ProteinID: NP_083351
MGI: 1921982
Ensembl: ENSMUSG00000039232
UniProt: Q9D3G5 Q3U5V8
Position
10; 10 A2
AA seq 287 aa AA seqDB search
MKDRLAELQELSRSYDQQFPDGDNDFDAPREDIVFETDHILESLYRVIQDIQDENQLLLI
DVRRLGRQNVRFLTSMRRLSSIKRDTNSIAKAIKTRGEGIHQKLRSMKELSEQAEARHGA
HSAVARISHAQYSALARAFQQAMYEYNQAEMKQRDNCKIRIQRQLEIMGKDMSGEQIEDM
FEQGKWDVFSENLLADLKGARAALNEIESRHRELLRLEGRIRDVHELFLQMAVLVEKQED
TLNVIELNVQKTLDYTGEAKAQVRKAVQYKKKNPCRTICCFCCPCVN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatcggcttgcagagcttcaagaattgtccaggagctatgaccagcaattccca
gatggggacaatgactttgacgctcctcgggaggacatagtgttcgagaccgaccacatc
ctggagtccttgtacagggtcatccaggacatccaggatgaaaaccagctgcttctgata
gacgtgaggcgcctggggaggcagaacgtccgcttcctcacgtccatgcggcgcctcagc
agcattaagcgcgacaccaactccatcgccaaggccatcaagacccgaggcgaaggcatc
caccagaagctgcgctccatgaaggagctgagcgagcaggccgaggcccggcacggcgcg
cactcggcggtggctcgcatctcacacgcgcagtacagcgcgctggcccgcgctttccag
caagccatgtacgagtacaaccaggccgagatgaaacagcgcgacaactgcaagatccgc
atccagcggcagctggagatcatgggcaaggacatgtcgggcgagcagattgaggacatg
ttcgagcagggcaagtgggatgtattctccgagaacctgctggccgacttgaagggcgcg
cgggctgcgctcaacgagatcgagagccgccaccgcgagctcctgcgcctggagggtcgc
attcgcgatgtgcacgagctcttcctacagatggccgtgctagtggagaagcaggaggac
acgctgaacgtcatcgagcttaacgtgcagaagaccctcgattacacgggcgaggccaag
gcgcaggtgcgcaaggcggtgcagtacaagaagaagaacccctgcaggaccatctgctgc
ttctgttgtccctgtgtcaactag

DBGET integrated database retrieval system