KEGG   Mus musculus (mouse): 74734
Entry
74734             CDS       T01002                                 

Gene name
Rhoh, 5830400A04Rik, AU019774, Ar, Arhh
Definition
(RefSeq) ras homolog family member H
  KO
K07873  Ras homolog gene family, member H
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04670  Leukocyte transendothelial migration
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    74734 (Rhoh)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    74734 (Rhoh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    74734 (Rhoh)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    74734 (Rhoh)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 SRPRB TniB PduV-EutP AAA_16 RsgA_GTPase
Other DBs
NCBI-GeneID: 74734
NCBI-ProteinID: NP_001074574
MGI: 1921984
Ensembl: ENSMUSG00000029204
Vega: OTTMUSG00000055241
UniProt: Q9D3G9 Q504M6
Position
5; 5 C3.1
AA seq 191 aa
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTA
GNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWISEIRSNLPCTPVLVVATQTDQ
REVGPHRASCINAIEGKRLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRR
KLFSINECKIF
NT seq 576 nt   +upstreamnt  +downstreamnt
atgctgagctcaatcaagtgcgtgctggtaggggacagtgctgtggggaaaacctcactg
ttggtgcgcttcacctctgagaccttcccggaggcctacaaacccacggtgtacgagaat
acgggtgtagacgtcttcatggatggcatccagatcagcctgggtctctgggacactgcc
ggcaacgacgccttcagaagtatccggcccctgtcctaccagcaggcagacgtggtactg
atgtgctactctgtggccaaccataactcgttcctgaacttgaagaacaaatggattagt
gagatcaggagcaacctaccctgtaccccggtgctggttgtggccacacagacggaccag
agagaggtgggacctcacagggcttcctgcatcaatgccatagaagggaagagacttgcc
caggatgtgagagccaagggctacctggagtgctcagccctcagcaaccggggagtacag
caggtatttgaatgtgctgtccgaacagctgtcaaccaggccaggaggcgaaacagaagg
aagctgttctccatcaatgaatgcaagatcttctaa

DBGET integrated database retrieval system