KEGG   Mus musculus (mouse): 74737
Entry
74737             CDS       T01002                                 

Symbol
Pcf11, 2500001H09Rik, 5730417B17Rik, C77803
Name
(RefSeq) PCF11 cleavage and polyadenylation factor subunit
  KO
K14400  pre-mRNA cleavage complex 2 protein Pcf11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    74737 (Pcf11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    74737 (Pcf11)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    74737 (Pcf11)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     74737 (Pcf11)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor IIm (CFIIm)
     74737 (Pcf11)
SSDB
Motif
Pfam: CID SHOCT CFIA_Pcf11
Other DBs
NCBI-GeneID: 74737
NCBI-ProteinID: NP_083354
MGI: 1919579
Ensembl: ENSMUSG00000041328
Vega: OTTMUSG00000029291
UniProt: Q8K0S1 G3X9Z4 Q69ZY3
Position
7:complement(92292666..92319284)
AA seq 1553 aa
MSEQTPAEAGAAGAREDACRDYQSSLEDLTFNSKPHINMLTILAEENLPFAKEIVSLIEA
QTAKAPSSEKLPVMYLMDSIVKNVGREYLTAFTKNLVATFICVFEKVDENTRKSLFKLRS
TWDEIFPLKKLYALDVRVNSLDPAWPIKPLPPNVNTSSIHVNPKFLNKSPDEPSTPGTVV
SSPSISTPPIVPDIQKNLTQEQLIRQQLLAKQKQLLELQQKKLELELEQAKAQLAVSLSV
QQETANLGPGSVPSKLHVPQIPTMAVKTPHQVPVQPDKSRAGPSLQMQDLKGTNRDPRLN
RMSQHSSHGKEQSHRKEFVMNTINQSDIKTSKNVPSEKLNSSKQEKSKSGERITKKELDQ
LDSKSKSKSKSPSPLKNKLSHTKDLKNQDSESMRLSDMSKRDPRLKKHLQDKAEGKDEDV
KEKRKTAEKKEKDEHMKSSEHRVIGSRSKIINGIVQKQDMVTEELEKQGTKPGRSSTRKR
SRSRSPKSRSPIIHSPKRRDRRSPKRRQRSMSPNLAPKAGKMRQSGLKQSHMEEFPPPSR
EERNIKRSAKQDVRDPRRLKKMDEDRPQETAGQHSMKSGGDPKENIENWQSSKSAKRWKS
GWEENKSLQQGDEHSKPPHLRHRESWSSTKGILSPRAPKQQHRLSVDANLQIPKELTLAS
KRELLQKTSERLASGEITQDEFLVVVHQIRQLFQYQEGVREEQRSPFNDRFPLKRPRYED
SDKPFVDGPASRFAGLDTNQRLTALAEDRPLFDGPGRPSVTRDGPAKMIFEGPNKLSPRI
DGPPTPGSLRFDGSPGQMGGGGPMRFEGPQGQLGGGCPLRFEGPPGPVGTPLRFEGPIGQ
GGGGGFRFEGSPSLRFEGSTGGLRFEGPGGQPVGGLRFEGHRGQPVGGLRFEGPHGQPVG
SLRFDNPRGQPVGGLRFEGGHGPSGAAIRFDGPHGQPGGGGGIRFEGPLLQQGVGMRFEG
PHGQSVAGLRFEGHNQLGGNLRFEGPHGQPGVGIRFEGPIVQQGGGMRFEGPVPGGGLRI
EGPLGQGGPRFEGCHSLRFDGQPGQPSLLPRFDGLHGQPGPRFERTGQPGPQRFDGPPGQ
QVQPRFDGVPQRFDGPQHQQASRFDIPLGLQGTRFDNHPSQRIESFNHSGPYNDPPGNTF
NVPSQGLQFQRHEQIFDTPQGPNFNGPHGPGNQNFPNPINRASGHYFDEKNLQSSQFGNF
GNLPTPISVGNIQASQQVLTGVAQPVAFGQGQQFLPVHPQNPGAFIQNPSGGLPKAYPDN
HLSQVDVNELFSKLLKTGILKLSQPDSATAQVTEAVAQPPPEEDEDQNEDQDVPDLTNFT
IEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHR
RWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVES
CEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENP
LNIMLNIVKNELQEPCESPKVKEEQIDAPPACSEESVATPTEIKTESDTVESV
NT seq 4662 nt   +upstreamnt  +downstreamnt
atgtcagagcagacgccggcggaggccggggctgcgggggcccgggaggacgcctgtcgg
gattatcagtcgtcgctggaagacctgaccttcaatagcaaaccgcacatcaatatgctg
accattctagccgaggagaacctgcccttcgccaaggagatcgtctctctcatcgaggcc
caaaccgccaaggctccttcctcagagaagcttccagttatgtaccttatggattctatc
gtgaaaaatgttggaagagaatatctcactgcctttactaaaaatctagttgcaacattt
atttgtgtgtttgaaaaggtggatgaaaatactagaaaaagtttatttaaattacgttcc
acatgggatgaaatattccctttgaagaaactttatgccttggatgtcagagtcaattca
ttagatcctgcttggcctattaaacctctgcctcctaatgtgaatacatctagcatccat
gtgaatcccaaatttttaaataaatcgcctgatgagccttcaacacctggcacagtggtc
agttcccccagtatctccactcctcccattgtacctgatatacaaaagaatcttacccaa
gaacaactaataaggcaacagttactggcaaaacaaaaacagttgttagaacttcagcag
aaaaagctggagcttgagttagaacaagctaaggcacagctggcagtatctctgagtgtt
cagcaggaaacagccaacttgggtcctggatcagtgccgtctaaattacatgttccacaa
attcccacaatggctgttaaaactccccatcaggtccctgtacaacctgacaaaagccga
gcaggtccatccttacaaatgcaagacttgaaaggaactaaccgggatccccgtcttaac
aggatgagccaacattcttcccatggcaaagagcagagtcataggaaagaatttgtaatg
aacacaataaaccagtctgatattaaaacaagtaagaatgtaccctctgaaaagctaaat
tcatccaaacaagaaaaaagtaaatcaggtgaaagaataaccaagaaagaacttgaccag
ttagattctaaatccaaatctaagtctaaatcaccatcacctttgaaaaacaaattatcc
cacacaaaagacttgaaaaatcaagactctgaaagtatgaggttgtctgatatgagtaag
agagatccacgattaaagaagcatcttcaggataaagctgagggcaaagatgaagatgta
aaagaaaagagaaaaactgcagaaaagaaggagaaagatgagcacatgaaatcatctgaa
cacagggtgattggaagtagaagtaaaatcataaatggcattgtccaaaaacaagacatg
gttacagaggagttggaaaaacaggggacaaaaccagggagatcgagtactagaaagaga
tcaagatcaaggtcacctaagtctcggtcaccaattatacattccccaaagagaagagat
agacggtcacccaaacgaaggcaaagaagtatgtctcccaatttggcacccaaagctgga
aagatgcgtcagtcgggactaaaacagtcacatatggaagaattcccaccaccttccagg
gaagaaagaaatattaagagaagtgctaagcaggatgttagagatcccagacgactgaaa
aagatggatgaggaccggcctcaagaaactgcaggtcaacattctatgaagtcaggtggt
gacccaaaggagaatatagagaattggcaaagctctaagtctgccaaaagatggaaatct
ggctgggaagaaaataaaagcttgcagcagggtgatgaacatagtaaacctcctcatcta
aggcatagggagagctggtcaagcactaaagggatcttgtcacctcgagcccccaagcag
cagcaccgactaagtgtagatgccaatcttcaaattcctaaagagttaactcttgcaagc
aaaagagaattgcttcaaaagacgagcgaacgtttagcatctggtgaaattacacaggat
gagttccttgttgttgtgcatcaaattcgacagctatttcagtatcaagaaggtgtacga
gaggagcagagatcaccattcaatgatcgttttccacttaagcgacctagatatgaagat
tcagataaaccatttgtagatggcccagcatcaagatttgctggccttgatacaaatcag
cgacttacagctctagctgaagaccgaccattatttgatggacctggtaggccatctgtg
acgagagatggcccagccaagatgatttttgaaggacctaataaattaagccctagaatt
gatggacctcctacaccaggttctcttcggtttgatgggtcaccaggacaaatgggggga
ggaggccctatgagatttgaaggaccacaaggtcagttaggaggtgggtgtcctttgaga
tttgaaggtcctccaggaccagtaggaacacctctgcggtttgaagggccaattggtcaa
ggaggaggaggtggttttcgatttgaaggttcacctagtttgaggtttgagggatctaca
ggtggtttacgatttgaaggaccagggggtcagcccgtgggtggtctcaggtttgaagga
catcgtggtcaacctgtgggtggtctcaggtttgaaggacctcatggacagcctgtgggc
agtcttagatttgataatcctcgaggtcagcctgtaggaggacttagatttgaagggggt
catggtccatcaggggctgcaattaggtttgatgggcctcatggtcagccaggtggtggt
ggtggtatcagatttgagggccctttgctacagcaaggagttggaatgaggtttgagggt
ccccatggtcagtctgtagctggtctgagatttgaaggacataatcaactaggtgggaac
cttaggtttgagggaccacatggtcaaccaggggttgggatcaggtttgaaggacctata
gttcaacaaggaggtggaatgaggtttgaaggtcctgtaccaggaggtggcctgagaatt
gaagggcctctgggtcaaggtggtcctagatttgaaggttgtcactctttaaggtttgat
ggacagccaggtcaaccatcacttttgccaagatttgatggattacatggccagccaggt
cctagatttgaaagaactggtcagccaggtccacagaggtttgatggaccacctggacag
caggttcaaccaagatttgatggtgtacctcaaagatttgatgggccacaacaccagcaa
gcatcaagatttgatattcctcttggtctacaaggaactcgatttgacaatcatccttca
caaaggattgaatctttcaatcattctggcccatataatgatccacctggcaatactttt
aatgttccatctcaaggattacagttccaaagacacgaacaaatatttgatacacctcaa
ggaccaaattttaatggaccacatggccctggaaatcagaatttcccaaatcccattaac
agagcttctggacactattttgatgaaaagaatcttcagagttctcagtttggaaacttt
ggcaatttgcctacaccaatatcagtaggaaatattcaggcatctcaacaggttcttact
ggtgttgctcagccagtagcgtttggccaaggacaacagttcttaccagttcatccacag
aatcctggagcttttattcaaaatccttcaggcggtcttcccaaggcatatcctgataat
catctcagtcaggtggatgtaaacgaattgttttcaaaactgctaaaaacaggaattctc
aaattgtcacagcctgattcagctacagcacaggtaaccgaggctgttgctcagcctccc
cctgaggaggacgaggatcagaatgaagatcaggatgttccagatcttaccaatttcacc
attgaagaattgaagcaacgttatgacagtgttataaaccggctgtacactgggattcaa
tgttactcgtgtggaatgaggttcacgacatcccagacagatgtttatgcagatcacttg
gattggcattatcggcaaaacagaaccgagaaagatgttagcagaaaagtcactcataga
cgttggtactacagtctaacagattggatagaatttgaagaaatagctgatctggaagaa
cgtgcaaaaagccagttttttgaaaaggttcatgaagaggttgtccttaaaactcaggag
gctgctaaagaaaaggagttccaaagtgtacctgctggaccagctggagcagttgagagt
tgtgaaatctgtcaagaacaatttgaacagtactgggatgaagaggaggaagaatggcac
ttaaaaaatgctattagagtagacggaaagatttaccatccatcatgttatgaagattat
caaaatacatcttcatttgattgcacaccatctcccagcaagacaccagttgaaaaccct
ttgaacattatgttgaacattgtcaaaaacgaattgcaagaaccctgtgaaagtcccaaa
gttaaggaagaacaaattgatgccccaccagcttgttcagaagaaagtgtagcaacaccc
actgaaattaaaacagaaagtgatacagttgagtcagtttaa

DBGET integrated database retrieval system