KEGG   Mus musculus (mouse): 74741
Entry
74741             CDS       T01002                                 

Gene name
C2cd5, 5730419I09Rik, C030008B15Rik, CDP138
Definition
(RefSeq) C2 calcium-dependent domain containing 5
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: C2 YbjQ_1
Other DBs
NCBI-GeneID: 74741
NCBI-ProteinID: NP_083357
MGI: 1921991
Ensembl: ENSMUSG00000030279
Vega: OTTMUSG00000057141
UniProt: Q7TPS5 Q3TSE2
Position
6; 6 G3
AA seq 1016 aa
MPGKLKVKIVAGRHLPVMDRASDLTDAFVEVKFGNTTFKTDVYLKSLNPQWNSEWFKFEV
DDEDLQDEPLQITVLDHDTYSANDAIGKVYIDIDPLLYSEAATVISGWFPIYDTIHGIRG
EINVVVKVDLFNDSNRFRQSSCGVKFFCTTSIPKCYRAVVIHGFVEELVVNEDPEYQWID
RIRTPRASNEARQRLISLMSGELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIG
TACTLDKLSSPAAFLPACSSPSRELKEIPFNEDPNPNTHSSGPSTPLKNQTYSFSPSKSY
SRQSSSSDTDLSLTPKTGMGSGSAGKEGGPFKALLRQQTQSALEQREFPFLTLTAFPPGL
LVHVGGVVSARSVKLLDRIHNPDEPETRDAWWAEIRQEIKSHAKALGCHAVVGYSESTSI
CEEVCILSASGTAAVLNPRFLQEGTVEGCLEQRIEENLPVGCGFCHIPYDELNMPFPAHL
TYCYNCRKQKVPDVLFTTIDLPTDAVVVGKGCLIQARLCRLKKKAQAEANATAISNLLPF
MEYEVHTQLMNKLKLKGMNALFGLRIQITVGETMLMGLASATGVYLAALPTPGGIQIAGK
TPNDGSYEQHISHMQKRINDTIAKNKELYEITPPEVSEEMIGSPIPEPRQRSRLLRSQSE
SSDEVTELDLSHGKKDAFVLEIDDTDAMEDVHSLLTDAPPPSGFYSCNTEIMPGINNWTS
EIQMFTSVRVVRLSSLNLTNQALNKNFNGLCENLLKSLYFKLRSMTPCCLCHVNFTVSLP
EDELIQVTVTAVAITFDKNQALQTTKPHVEKSLQRASTDNEELLQFPLELCSDSLPPHPF
PAAKEHLESANSNSGIPAAQRAVTVEKASAMGDGNFRNRSAPPCASPTVGVVKMTPLSFI
PGAKITKYLGIINMFFIRETTSLREEGGVSGFLHAFIAEVFAMVRAHVAALGGNAVVSYI
MKQCVFMENPSKNQAQCLINVSGDAVVFVRDSDLEVMSSQQPAANCQPSCTGEVTT
NT seq 3051 nt   +upstreamnt  +downstreamnt
atgccggggaagctgaaggtgaaaattgtggccggtcgccatttgccggtgatggaccgt
gccagtgacctgacggatgccttcgtggaggtaaaatttggtaatacaacctttaagaca
gatgtgtatctcaagtcactgaatcctcagtggaactcggagtggtttaaatttgaggtg
gacgatgaagatttacaggatgagcctctgcagatcacagttcttgaccacgatacttac
agtgcaaacgatgctattggcaaggtgtacattgacatcgaccctttactgtacagtgaa
gctgccacagtcatctcaggctggttcccaatttatgacaccatacatggtatccgcgga
gaaatcaatgttgtggttaaagtagacctcttcaatgattcaaacaggttcagacagtct
tcatgtggagttaaattcttttgcacaacatctattccaaagtgctacagagctgtggta
atccacggatttgtagaagaacttgtggtcaatgaggatcccgagtatcagtggattgat
cggatccgcaccccaagggcatcgaatgaagccaggcagagactcatctccttgatgtca
ggtgaattacagagaaagattggcttgaaagtcctcgagatgagagggaatgcagttgtt
gggtacttgcagtgctttgatctggagggcgagtctgggttagtggtccgagccatagga
acggcgtgcactctggataaactgagcagcccagcagcgttccttcctgcatgcagctcc
ccatccagagaactgaaggagattcccttcaatgaggatcccaaccccaatactcactca
tcaggaccctcaacccctctgaaaaaccaaacttattccttttcaccttccaagtcctac
agtcggcagtcctcttcttctgacacagatttgagtttgacacccaagactggaatgggc
agtgggagtgctggaaaagaaggggggccctttaaagcccttttacggcaacagacgcag
tcggcgttggaacagcgggagttcccgttcctcaccctgacggccttcccccctggactt
cttgtgcacgtcggtggcgttgtcagtgcacgctctgtgaagcttttagatcggatccac
aaccctgatgaaccagaaactcgagatgcatggtgggcagaaatcagacaagagataaag
tcacatgctaaagccttaggctgccatgctgtagtgggctacagcgagtcaaccagcatc
tgtgaagaagtctgtattttatcagcgtctggcacggcagctgtgctgaaccctcggttt
ctgcaggaaggcactgtggagggctgtttggaacaaaggattgaagagaatttaccggtg
ggctgcggattctgccatataccatatgatgaactgaacatgccgtttcccgctcatctc
acatattgctataactgcaggaagcaaaaagtccctgatgttctcttcacaactatcgat
ctgcccacagacgcagtggttgttggtaaaggttgtcttattcaggcaaggttatgtcga
ttaaaaaagaaagcacaggcagaagccaatgccacagctatcagtaatctcttgccgttt
atggaatatgaagtacacactcaactgatgaacaagctcaaactcaaaggaatgaatgct
ttgtttggactgagaattcagatcacagtgggcgagaccatgctgatgggcttagcgtcg
gccacaggagtctacttagcagccttacccacacccggtggaatccagatcgctgggaag
acccctaatgatggctcctatgaacagcacatctcccacatgcagaagagaataaacgac
accattgcaaaaaacaaagagctgtatgagatcacccccccggaggtgtctgaggagatg
ataggatcccccatcccagaacccagacagcgctccagacttctaagatcacagtcggaa
agttctgatgaagttacagagttagatctttcacacgggaaaaaggatgcttttgtttta
gagatcgatgacaccgatgccatggaagatgtgcactccctccttactgacgccccgccc
ccttcaggtttttatagttgtaatacagaaattatgcctggcataaataactggacatca
gaaatacagatgttcacgtcagtaagagtggtcagactaagtagcctcaacttgactaac
caagctctcaataagaacttcaacggcctatgtgagaacttgctcaagagcctgtatttc
aaacttcggtccatgaccccctgctgcctctgccatgtgaactttacagtgtctctgcct
gaagatgagttaatccaggtcacagtcacagcagttgcaataacttttgataaaaaccag
gccttacagaccacaaaaccccacgttgaaaagtcactacaaagagcctccacagataac
gaagaactgctgcagttcccactggagctctgctcagactcactgcctcctcatcctttc
ccagcagctaaagaacacctggagagtgcgaactctaactcaggtataccagctgcacag
agagctgtgactgttgaaaaagcaagtgccatgggtgatggaaatttccggaatcgctct
gctccaccttgtgcaagtcccacagttggggttgttaagatgacgccgctttctttcatc
cctggagcaaagataaccaagtacctcggcatcattaacatgtttttcattcgggaaacc
acttctctccgcgaggaaggcggagtcagtggttttctccacgctttcattgctgaagtg
tttgccatggtccgagctcacgtggcagcgctgggcgggaatgctgttgtgtcctacatc
atgaagcagtgtgtcttcatggagaaccccagtaagaaccaggcacagtgtctcataaat
gtcagtggggacgcggtggtgtttgttcgtgactccgacttagaggtcatgtcatctcag
cagcctgctgccaactgccagccctcatgtaccggagaagttacaacttga

DBGET integrated database retrieval system