KEGG   Mus musculus (mouse): 74747
Entry
74747             CDS       T01002                                 

Gene name
Ddit4, 5830413E08Rik, AA415483, Dig, REDD, REDD1, Rtp8, Rtp801, dig2
Definition
(RefSeq) DNA-damage-inducible transcript 4
  KO
K08270  DNA-damage-inducible transcript 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    74747 (Ddit4)
   04150 mTOR signaling pathway
    74747 (Ddit4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    74747 (Ddit4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    74747 (Ddit4)
SSDB
Motif
Pfam: RTP801_C
Other DBs
NCBI-GeneID: 74747
NCBI-ProteinID: NP_083359
MGI: 1921997
Ensembl: ENSMUSG00000020108
UniProt: Q9D3F7 B7ZNP9
Position
10; 10 B4
AA seq 229 aa
MPSLWDRFSSSSSSSSSSRTPAADRPPRSAWGSAAREEGLDRCASLESSDCESLDSSNSG
FGPEEDSSYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLSQARLGSRRPARLLMPSQL
VSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVAQLALDPSLVPTFQLTLVLRLDS
RLWPKIQGLLSSANSSLVPGYSQSLTLSTGFRVIKKKLYSSEQLLIEEC
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcctagcctctgggatcgtttctcgtcctcctcttcctcttcgtcctcgtctcgaact
ccggccgctgatcggccgccgcgctccgcctgggggtctgcagccagagaagagggcctt
gaccgctgcgcgagcctggagagctcggactgcgagtccctggacagcagcaacagtggc
ttcgggccggaggaagactcctcatacctggatggggtgtccctgcccgactttgagctg
ctcagtgaccccgaggatgagcacctgtgtgccaacctgatgcagctgctgcaggagagc
ctgtcccaggcgcgattgggctcgcggcgccctgcgcgtttgctcatgccgagccagctg
gtgagccaggtgggcaaggaactcctgcgcctggcatacagtgagccgtgcggcctgcgg
ggggcactgctggacgtgtgtgtggagcaaggcaagagctgccatagcgtggctcagctg
gccctcgaccccagcctggtgcccacctttcagttgaccctggtgctgcgtctggactct
cgcctctggcccaagatccaggggctgttaagttctgccaactcttccttggtccctggt
tacagccagtccctgacgctaagtaccggcttcagagtcatcaagaagaaactctacagc
tccgagcagctgctcattgaagagtgttga

DBGET integrated database retrieval system