KEGG   Mus musculus (mouse): 74761Help
Entry
74761             CDS       T01002                                 

Gene name
Mxra8, 1200013A08Rik, 1700095D18Rik, AI131686, Asp3, Dicam
Definition
(RefSeq) matrix-remodelling associated 8
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 I-set Ig_6 DUF347
Motif
Other DBs
NCBI-GeneID: 74761
NCBI-ProteinID: NP_077225
MGI: 1922011
Ensembl: ENSMUSG00000029070
Vega: OTTMUSG00000010893
UniProt: Q9DBV4
Structure
PDB: 

Position
4 E2; 4 87.58 cM
AA seq 442 aa AA seqDB search
MELLSRVLLWKLLLLQSSAVLSSGPSGTAAASSSLVSESVVSLAAGTQAVLRCQSPRMVW
TQDRLHDRQRVVHWDLSGGPGSQRRRLVDMYSAGEQRVYEPRDRDRLLLSPSAFHDGNFS
LLIRAVDRGDEGVYTCNLHHHYCHLDESLAVRLEVTEDPLLSRAYWDGEKEVLVVAHGAP
ALMTCINRAHVWTDRHLEEAQQVVHWDRQLPGVSHDRADRLLDLYASGERRAYGPPFLRD
RVSVNTNAFARGDFSLRIDELERADEGIYSCHLHHHYCGLHERRVFHLQVTEPAFEPPAR
ASPGNGSGHSSAPSPDPTLTRGHSIINVIVPEDHTHFFQQLGYVLATLLLFILLLITVVL
ATRYRHSGGCKTSDKKAGKSKGKDVNMVEFAVATRDQAPYRTEDIQLDYKNNILKERAEL
AHSPLPAKDVDLDKEFRKEYCK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgtcccgcgtcctgctgtggaaactgctgcttcttcagagctctgcagtc
ctgtcctcagggccttcagggaccgcagcagccagcagctctctggtgtctgagtctgtg
gtgagcttggcagccggaacccaggctgtgctacgctgccagagcccccgcatggtgtgg
acccaagaccggctgcatgatcgccagcgcgtggtccactgggacctcagcgggggcccg
ggcagccaacggcgccgacttgtggatatgtattcggcgggtgaacagcgcgtgtacgag
ccgcgcgatcgcgaccgcctcctgctgtcgccttctgctttccacgacggcaacttctcg
ctgctcattcgcgctgtggacagaggcgatgaaggggtgtacacctgcaacctgcaccat
cactactgccacctcgatgagagcctggctgtgcgcctcgaggttacagaggatccccta
ttaagtcgcgcatactgggacggtgagaaggaagtgttggtggtggcccatggcgcgccg
gcactgatgacctgcatcaaccgtgcgcacgtgtggactgaccgccatttagaggaggcg
cagcaggtggtccattgggaccgacagctacctggggtgtcacacgaccgcgccgaccgc
ctgcttgacctgtatgcatctggcgagcgccgcgcctatgggccacccttcctgcgtgat
cgcgtgtcagtgaacaccaacgcttttgcacgcggtgacttctccctacgcatcgatgag
ctggagcgagctgatgagggcatctattcctgccacctgcaccatcactactgtggcctc
cacgagcgccgagtcttccacctacaggtcacagagcctgcctttgagccaccagctcgt
gcttctcctggcaatgggtctggtcacagcagtgctcctagcccagatcccaccctgacc
cgaggccacagcatcatcaatgtcattgtcccagaggaccacacacatttcttccagcaa
ctgggctatgtgttggccacgctgctgctcttcatcttgctgctcatcactgtagtcctg
gctacacgatatcgtcacagcggaggatgcaagacgtcggacaaaaaagctgggaagtca
aaggggaaggatgtgaacatggtggagtttgctgtagccacaagggatcaggctccatat
aggactgaggacatccagctagattacaaaaacaacatcctgaaggagagggctgagctg
gcccatagtcctctgcctgccaaggatgtggatctggataaagagttcaggaaggagtac
tgcaaataa

DBGET integrated database retrieval system