KEGG   Mus musculus (house mouse): 74761
Entry
74761             CDS       T01002                                 
Symbol
Mxra8, 1200013A08Rik, 1700095D18Rik, AI131686, Asp3, Dicam
Name
(RefSeq) matrix-remodelling associated 8
  KO
K24402  matrix remodeling-associated protein 8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74761 (Mxra8)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    74761 (Mxra8)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 DUF347
Other DBs
NCBI-GeneID: 74761
NCBI-ProteinID: NP_077225
MGI: 1922011
Ensembl: ENSMUSG00000029070
UniProt: Q9DBV4
Structure
Position
4:155924137..155928559
AA seq 442 aa
MELLSRVLLWKLLLLQSSAVLSSGPSGTAAASSSLVSESVVSLAAGTQAVLRCQSPRMVW
TQDRLHDRQRVVHWDLSGGPGSQRRRLVDMYSAGEQRVYEPRDRDRLLLSPSAFHDGNFS
LLIRAVDRGDEGVYTCNLHHHYCHLDESLAVRLEVTEDPLLSRAYWDGEKEVLVVAHGAP
ALMTCINRAHVWTDRHLEEAQQVVHWDRQLPGVSHDRADRLLDLYASGERRAYGPPFLRD
RVSVNTNAFARGDFSLRIDELERADEGIYSCHLHHHYCGLHERRVFHLQVTEPAFEPPAR
ASPGNGSGHSSAPSPDPTLTRGHSIINVIVPEDHTHFFQQLGYVLATLLLFILLLITVVL
ATRYRHSGGCKTSDKKAGKSKGKDVNMVEFAVATRDQAPYRTEDIQLDYKNNILKERAEL
AHSPLPAKDVDLDKEFRKEYCK
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggagctgctgtcccgcgtcctgctgtggaaactgctgcttcttcagagctctgcagtc
ctgtcctcagggccttcagggaccgcagcagccagcagctctctggtgtctgagtctgtg
gtgagcttggcagccggaacccaggctgtgctacgctgccagagcccccgcatggtgtgg
acccaagaccggctgcatgatcgccagcgcgtggtccactgggacctcagcgggggcccg
ggcagccaacggcgccgacttgtggatatgtattcggcgggtgaacagcgcgtgtacgag
ccgcgcgatcgcgaccgcctcctgctgtcgccttctgctttccacgacggcaacttctcg
ctgctcattcgcgctgtggacagaggcgatgaaggggtgtacacctgcaacctgcaccat
cactactgccacctcgatgagagcctggctgtgcgcctcgaggttacagaggatccccta
ttaagtcgcgcatactgggacggtgagaaggaagtgttggtggtggcccatggcgcgccg
gcactgatgacctgcatcaaccgtgcgcacgtgtggactgaccgccatttagaggaggcg
cagcaggtggtccattgggaccgacagctacctggggtgtcacacgaccgcgccgaccgc
ctgcttgacctgtatgcatctggcgagcgccgcgcctatgggccacccttcctgcgtgat
cgcgtgtcagtgaacaccaacgcttttgcacgcggtgacttctccctacgcatcgatgag
ctggagcgagctgatgagggcatctattcctgccacctgcaccatcactactgtggcctc
cacgagcgccgagtcttccacctacaggtcacagagcctgcctttgagccaccagctcgt
gcttctcctggcaatgggtctggtcacagcagtgctcctagcccagatcccaccctgacc
cgaggccacagcatcatcaatgtcattgtcccagaggaccacacacatttcttccagcaa
ctgggctatgtgttggccacgctgctgctcttcatcttgctgctcatcactgtagtcctg
gctacacgatatcgtcacagcggaggatgcaagacgtcggacaaaaaagctgggaagtca
aaggggaaggatgtgaacatggtggagtttgctgtagccacaagggatcaggctccatat
aggactgaggacatccagctagattacaaaaacaacatcctgaaggagagggctgagctg
gcccatagtcctctgcctgccaaggatgtggatctggataaagagttcaggaaggagtac
tgcaaataa

DBGET integrated database retrieval system