KEGG   Mus musculus (house mouse): 74763
Entry
74763             CDS       T01002                                 
Symbol
Naa60, 1200013P24Rik, AI315146, HAT4, Nat15, NatF
Name
(RefSeq) N(alpha)-acetyltransferase 60, NatF catalytic subunit
  KO
K21121  N-alpha-acetyltransferase 60 [EC:2.3.1.259]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    74763 (Naa60)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.259  N-terminal methionine Nalpha-acetyltransferase NatF
     74763 (Naa60)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    74763 (Naa60)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 Nudix_hydro Acetyltransf_15
Other DBs
NCBI-GeneID: 74763
NCBI-ProteinID: NP_083366
MGI: 1922013
Ensembl: ENSMUSG00000005982
UniProt: Q9DBU2
Position
16:3690365..3722645
AA seq 242 aa
MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYR
GAIVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGIGSLLLESL
KDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFRQHHYLPYYYSIRGVLKDGFTYVLY
INGGHPPWTILDYIQHLGSALANLSPCSIPHRIYRQAHSLLCSFLPWSSISTKGGIEYSR
TM
NT seq 729 nt   +upstreamnt  +downstreamnt
atgacagaggtggtgccttccagcgccctcagcgaggtcagcctgcgcctcctctgccac
gatgacatagacactgtgaagcacctgtgtggcgactggtttcccattgagtacccagac
tcatggtatcgtgatatcacatccaacaagaagttcttctcccttgctgcaacctacaga
ggtgccattgtgggaatgatagtagctgaaataaagaataggaccaaaatccataaagag
gatggagatattctagcctccagcttctctgtggatacacaagttgcatacatcctcagt
ctgggagtggtgaaagagttcaggaaacacggcataggttcccttttactagaaagttta
aaggatcatatttcaaccaccgcccaggaccactgcaaagccatctacctgcatgttctc
accaccaacaatacagcaataaacttctatgaaaacagagactttaggcagcatcactat
ctgccctactactactccattcgaggggtcctcaaagatggcttcacctatgtcctctac
atcaatggcggccaccctccctggaccattttagactacatccagcacctgggctcagca
ctagccaacctgagcccctgctccatcccacacaggatctaccgccaggcccacagcctg
ctctgcagctttctgccatggtccagcatttccaccaaaggtggcatagagtacagccgt
accatgtaa

DBGET integrated database retrieval system