KEGG   Mus musculus (mouse): 74764
Entry
74764             CDS       T01002                                 

Gene name
Klc4, 1200014P03Rik, AA408085, AW146303, Kn, Knsl8
Definition
(RefSeq) kinesin light chain 4
  KO
K10407  kinesin light chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    74764 (Klc4)
   05012 Parkinson disease
    74764 (Klc4)
   05014 Amyotrophic lateral sclerosis
    74764 (Klc4)
   05016 Huntington disease
    74764 (Klc4)
   05020 Prion disease
    74764 (Klc4)
   05022 Pathways of neurodegeneration - multiple diseases
    74764 (Klc4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    74764 (Klc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    74764 (Klc4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    74764 (Klc4)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     74764 (Klc4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     74764 (Klc4)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_8 TPR_MalT TPR_16 TPR_19 TPR_14 TPR_17 ANAPC3 PPR JIP_LZII RPN7 LUD_dom TMF_DNA_bd TMF_TATA_bd Csm1_N CENP-F_leu_zip COG2
Other DBs
NCBI-GeneID: 74764
NCBI-ProteinID: NP_083367
MGI: 1922014
Ensembl: ENSMUSG00000003546
UniProt: Q9DBS5
Position
17; 17 C
AA seq 619 aa
MSGLVLGQRDEPAGHRLSQEEILGSTKVVSQGLEALHSEHQAVLQSLSHTIECLQQGGHE
EGLVHEKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLR
DELAGTQQRLQRSEQAVAQLEEEKKHLEFLRQLRQYDEDGHGMEEKEGEATKDSLDDLFP
NEEEEDSGNDLSRGQGAAAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED
LERTSGRGHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGRDHPAVAATLNN
LAVLYGKRGKYKEAEPLCQRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYEAVERYY
QRALAIYESQLGPDNPNVARTKNNLASCYLKQGKYSEAEALYKEILTCAHVQEFGSVDDD
HKPIWMHAEEREEMSRSRPRDSSAPYAEYGGWYKACRVSSPTVNTTLKNLGALYRRQGKL
EAAETLEECALRSRKQGTDPISQTKVAELLGEGDGRKAIQEGPGDSVKFEGGEDASVAVE
WSGDGSGTLQRSGSLGKIRDVLRRSSELLVRKLQGTEPRPSSSSMKRAASLNYLNQPNAA
PLQVSRGLSASTVDLSSSS
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtcaggcttggtgttggggcagcgggatgagcctgcagggcaccggctcagtcaagag
gagatcttgggcagcaccaaggtggtgagccaagggctggaggccctacacagtgaacat
caggcagtgctgcagagcctgtcccacaccattgagtgtctgcaacagggaggccatgag
gaaggactggtccatgagaaggcccggcagctgcggcggtctatggagaacatcgagctg
gggctgagcgaggcccaggtgatgctggcgctggctagccacctgagcacagtggagtct
gagaagcagaagctgcgagcccaagtgcggcggctatgccaggagaatcagtggctccgg
gatgagctggcgggcactcagcagcgcctgcagcgcagcgagcaggctgtggctcagcta
gaggaagagaagaagcacctggagttcctgcggcagctgcggcagtatgatgaggacggc
cacggcatggaggagaaggagggagaggccaccaaagattctctggatgacctgttcccc
aatgaggaggaggaggactccggcaacgacttgtcccgtggtcagggtgctgcagcggcc
cagcagggtggatatgagatcccagcaaggttgcggaccctgcacaacctggtcatccag
tatgcagctcagggtcgctatgaggtggcggtgccactctgcaagcaagcgctagaggac
ctggagcgcacatctggccgaggtcaccctgatgtggctaccatgctcaacatcctggct
ctggtgtaccgggaccagaataagtacaaggaggctgctcatctgctgaacgatgctctc
agcatccgggagagcaccctgggccgggaccacccagccgtggctgccacactcaacaat
ctggctgtgctgtacggcaaacgcggtaaatacaaggaggcagagccactgtgccagcgg
gcactggagatccgagagaaggtcttgggcactgaccatccagatgtggcaaaacagctg
aacaacttggccctcctatgtcaaaaccagggcaagtacgaggcggtggaacgctattat
cagcgggcactagccatctatgagagccagctagggccagacaaccctaatgtagctcgg
accaagaataacctggcttcctgctacctaaagcagggcaagtactctgaggccgaggct
ctgtacaaagagatcctgacctgtgcccatgtgcaggagttcgggtctgtggatgatgac
cacaagccgatctggatgcatgctgaggaacgggaggagatgagcaggagccggccccgt
gacagcagtgcgccctatgcagagtacggagggtggtacaaggcctgcagagtgagcagc
cccacagtgaacactactctgaaaaacctaggggctctgtacaggcgccaggggaagctg
gaggcagccgagaccctggaggaatgtgctctgcgctcccggaaacagggtactgacccc
atcagtcagaccaaggtggcagagctgctcggggaaggagatggtagaaaggccatccag
gagggtcctggagacagcgtgaagttcgagggaggtgaagacgcatcagtggctgtggag
tggtcaggggatggcagtggcaccctccagaggagcggctctctgggcaagatccgggat
gtgcttcgtaggagcagtgagctactggtgaggaagctccaggggacggagccgcgacct
tccagcagcagcatgaagcgggcggcctcgctgaactacttaaaccaacccaatgcagcc
cccctccaggtctcccggggcctcagcgccagcactgtggacctttcttcaagtagctga

DBGET integrated database retrieval system