KEGG   Mus musculus (mouse): 74770
Entry
74770             CDS       T01002                                 

Gene name
Hhatl, 1110011D13Rik, Gup, Gup1, Mg56
Definition
(RefSeq) hedgehog acyltransferase-like
  KO
K24679  protein-cysteine N-palmitoyltransferase HHAT-like protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    74770 (Hhatl)
SSDB
Motif
Pfam: MBOAT Cytochrom_B558a
Other DBs
NCBI-GeneID: 74770
NCBI-ProteinID: NP_083371
MGI: 1922020
Ensembl: ENSMUSG00000032523
Vega: OTTMUSG00000062671
UniProt: Q9D1G3
Position
9; 9 F4
AA seq 503 aa
MGIKTALPAAELGLYSLVLSGALAYAGRGLLEASQDGAHRKAFRESVRPGWEYLGRKMDV
ADFEWVMWFTNFRNVIVFALSGHVLFAKLCTMVAPQLRSWMYAVYGVLAVVGTMGPWYLL
LLLGHCMVLYVASLLGQRWLCLALGLASLASFKVDPGISWQSGFVTGTFDLQDVLFHGGS
SFTVLRCTSFALESCAHPDRRYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQEPVRPE
GELWHIQAQAGLSAAAIVAVDVFFHFFYILTIPSDLKFASRLPDSALAGLAYSNLVYDWV
KAAVLFGVVNTVARLDHLDPPQPPKCITALYVFGETHFDRGINDWLCKYVYDHIGGDHST
VIPELAASVATFVVTTLWLGPCDIVYLWSVLNCFGLNFELWVQKLAERGPLAQIEARLSE
QMSRRVRALCGAVNFWAIIMYNLVSLNSLEFTELVARRLILTGFPQTTLAVLFVTYCGVQ
LVKERERSLALEEEQRQDREKLE
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgggcatcaagacagcactgcctgcagctgagctcggcctctattcactggtgctgagc
ggtgccctggcttatgccggccgaggtctcctggaggcatcacaagatggggcccacagg
aaggccttccgggagtctgtgagacctggctgggagtacctgggccggaagatggatgtg
gctgacttcgagtgggtgatgtggtttaccaacttccgaaatgtcattgtctttgccctc
tctggacacgtgctgtttgccaaactctgcacgatggtggccccccagctccgctcctgg
atgtatgctgtatatggagtcctggctgtggtgggcacaatgggcccatggtacctgctg
ctgctgcttggccactgtatggtcctctatgtggcctcactcttgggccagcgttggctg
tgccttgcccttggtctggccagcttggcgtccttcaaggttgaccctggaatctcttgg
cagagtgggtttgtaacaggcacctttgatcttcaagacgtactgttccacggtggcagc
agcttcacagttctgcggtgcaccagcttcgccctggagagctgcgcccaccccgaccgc
cgctactcccttgctgacctgctcaagtacaatttctacttgcccttcttcttcttcgga
cccatcatgaccttcgaccgcttccatgctcaggtgagccaggagccagtgaggccagag
ggcgagctatggcacattcaggcccaggcgggactcagcgcggcagccatcgtggctgtt
gacgtcttctttcacttcttctacatcctcaccatccccagcgatctcaagttcgccagc
cgcctcccagacagtgctcttgctggcctggcgtactcaaacctggtgtatgactgggtg
aaggcagcggtcctgtttggtgttgtcaacactgtggcacgcctggaccacctggaccct
cctcagcctcccaagtgcattactgcgctctatgtcttcggggaaacgcacttcgaccgt
ggtatcaatgattggctttgcaaatatgtgtatgaccacattggcggggatcactccacc
gtgatcccagagctggccgcatctgtggccacgttcgtcgtcaccactctgtggctcggg
ccttgtgacatcgtctacctgtggtctgttcttaactgcttcggcctcaactttgagctc
tgggtacagaagctggcagagcgtgggccactggcacagatagaggcccggctatcagag
cagatgtctcggagggtccgggccctctgcggggctgtaaatttctgggctatcatcatg
tacaacctcgtgagcctgaacagccttgaattcacagagctggttgcccgacgcctgata
cttacaggcttcccccagaccacactggcggtcttgtttgtcacctactgtggtgtccag
ctggtaaaggagcgtgagagatccctggcactggaggaggagcagcggcaggacagagag
aagctggagtag

DBGET integrated database retrieval system