KEGG   Mus musculus (house mouse): 74778
Entry
74778             CDS       T01002                                 
Symbol
Rrp7a, 1110014J01Rik, AA408146, Kheg1
Name
(RefSeq) ribosomal RNA processing 7 homolog A
  KO
K14545  ribosomal RNA-processing protein 7
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    74778 (Rrp7a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    74778 (Rrp7a)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    74778 (Rrp7a)
SSDB
Motif
Pfam: RRP7 RRM_Rrp7 RRM_1 DUF5093 BRI3
Other DBs
NCBI-GeneID: 74778
NCBI-ProteinID: NP_083377
MGI: 1922028
Ensembl: ENSMUSG00000018040
UniProt: Q9D1C9
Position
15:complement(83000047..83007002)
AA seq 280 aa
MVSRRKKRKAGGHEESIPSPPGYSAVPVKFSAKQQAPHYLYMRQHRVRQGTQSTWPPDRT
LFILNVPPYCTQESLSRCLSCCGTIKTVELQEKPDLAESPTEPKSQFFHPKPVPGFQVAY
VVFQKPSGVSAALNLKGPLLVSTESHLVKSGIHKWISDYEDSVLDPEALRMEVDAFMEAY
DKKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLEKEKRKRARKELLN
FYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKFRPY
NT seq 843 nt   +upstreamnt  +downstreamnt
atggtgtctcgcaggaagaaacggaaggctggcggccacgaggagagcataccgagccca
ccggggtattcagctgttccagtcaagttctcggcaaagcagcaggctcctcattacctc
tacatgagacagcaccgagttcgccaaggcacccagtccacatggcctcccgatcgaacc
ctttttatccttaatgtgcccccgtactgcacacaggagagcctgtctcggtgcctctcc
tgttgcggcaccatcaagacagtggagctgcaggagaagcccgaccttgccgagagcccc
acggagccaaagtcacagtttttccatcccaagccggtgccgggctttcaggtagcttat
gtggtgttccagaagccaagtggagtgtcggccgccttgaacctgaagggcccattgctg
gtttctacagagagccaccttgtgaagagcggaattcacaagtggatcagcgactatgaa
gactccgtgctggaccctgaggccctgagaatggaagtagacgcattcatggaggcctat
gacaagaagatagctgaggaggaggctaaggccaaggaagaggagggagtacctgacgag
gagggctgggtgaaggtcacccgccggggccgcaggcctgtgctccctcggacggaagcg
gccagcctgcgtgttctcgagaaggagaaacggaagcgtgcccgcaaggagctgctcaac
ttctatgcctggcagcaccgagagaccaagatggagcacctggcacagctgcgaaagaag
tttgaggaggacaagcagaggatcgaactgatgcgggcccagcgtaaattccgaccctac
tga

DBGET integrated database retrieval system