KEGG   Mus musculus (house mouse): 74838
Entry
74838             CDS       T01002                                 
Symbol
Naa15, 5730450D16Rik, 6330400I15, ASTBDN, Narg1, Tbdn-1, mNAT1
Name
(RefSeq) N(alpha)-acetyltransferase 15, NatA auxiliary subunit
  KO
K20792  N-alpha-acetyltransferase 15/16, NatA auxiliary subunit
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    74838 (Naa15)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    74838 (Naa15)
SSDB
Motif
Pfam: NatA_aux_su TPR_2 TPR_19 TPR_8 TPR_1 ANAPC3 TPR_11 TPR_9 TPR_12 TPR_15 DUF6057 Vfa1 Peptidase_S30 Coilin_N
Other DBs
NCBI-GeneID: 74838
NCBI-ProteinID: NP_444319
MGI: 1922088
Ensembl: ENSMUSG00000063273
Vega: OTTMUSG00000051598
UniProt: G3X8Y3
Position
3:51323437..51383406
AA seq 865 aa
MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLG
KKEEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDL
SLLQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQT
SPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL
EDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNF
LSGEKFKECLDRFLRMNFSKGCPPVFNTLRSLYRDKEKVAIVEELVVGYETSLKSCRLFN
PNDDGKEEPPTTLLWVQYYLAQHYDKIGQPSIALEYINTAIESTPTLIELFLVKAKIYKH
AGNIKEAARWMDEAQALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLN
EMQCMWFQTECAQAYKAMNKFGEALKKCHEIERHFIEITDDQFDFHTYCMRKITLRSYVD
LLKLEDVLRQHPFYFKAARIAIEIYLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQR
RAQKKAQIEEEKKNAEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKF
LTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSSHPWLHECMIRLFHSVC
ESKDLPETVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVYYLDSSSQK
RAIELATTLDGSLTNRNLQTCMEVLEALCDGSLGDCKEAAEAYRASCHKLFPYALAFMPP
GYEEDMKITVNGDSSAETEELANEI
NT seq 2598 nt   +upstreamnt  +downstreamnt
atgccggccgtgagcctcccgcccaaggagaacgcgctcttcaagcggatcttgagatgt
tatgaacataaacagtatagaaatggattgaagttctgtaaacaaatcctttccaatccc
aaatttgcagagcatggagaaaccctggctatgaaaggattaacgttgaactgtttggga
aaaaaggaagaagcttatgaattggttcgcagaggtttgagaaatgacttaaagagtcat
gtgtgttggcatgtttatggccttcttcaaaggtcagacaagaagtatgatgaagccatt
aagtgctacagaaatgcactgaaatgggataaagacaatcttcagatcttaagagatctt
tccttactgcagattcaaatgcgagatcttgagggctatagggaaacaagataccagttg
cttcagcttcggcctgcacagagagcatcatggattggttatgctattgcttaccattta
ttagaagactatgaaatggcagcaaaaattttagaagagtttaggaaaacacagcagaca
tctcctgataaagtggattatgaatatagtgaactcctcttatatcagaatcaagttctt
cgggaagcaggtctttatagagaagccctggaacatctttgtacctatgaaaagcagatt
tgtgataaacttgctgttgaagaaaccaaaggggaacttctgttgcagttgtgtcgtttg
gaagatgctgctgacgtttatagaggattacaagagaggaatcctgaaaattgggcctat
tacaaaggcttagaaaaagcactgaagccagctaatatgttagaacggctaaaaatatat
gaggaagcctggactaaataccccaggggactcgtgccaagaaggctgcccttaaacttt
ttatctggagagaagtttaaggagtgtttggataggttcctaaggatgaatttcagcaag
ggctgtccacctgtcttcaataccttgaggtctttatacagagataaagagaaggtggca
atcgtagaagaactagtagttggttatgaaacttctctaaaaagttgtcgcctatttaac
cccaatgatgatggaaaggaggaacctccaaccacattactttgggtccagtactatttg
gcacagcattatgataaaattggtcagccatccattgctctggaatacataaatactgca
attgaaagtacaccaacattgatagaactctttcttgtaaaagctaaaatctataagcat
gctgggaatattaaagaagctgccaggtggatggatgaagcccaggccctggacacagca
gacagatttattaattccaagtgtgcaaaatacatgttaaaagccaacctgattaaagag
gctgaagaaatgtgttccaagtttacgagggaaggaacttcagcggtagagaacctgaat
gaaatgcagtgtatgtggttccagacagagtgtgctcaggcatacaaagcaatgaacaaa
tttggtgaagcacttaagaaatgtcatgaaattgagagacattttatagaaatcaccgat
gaccagtttgactttcatacatactgtatgaggaagatcacccttagatcatatgtggac
ttattaaaactagaagatgtacttcgacagcatccattttacttcaaagcagcgaggatt
gctattgagatctatttgaagcttcatgacaaccctctgacagatgagaacaaagaacac
gaggctgatacagcaaacatgtctgacaaagagctaaagaaactgcgtaataaacaaaga
agagctcaaaagaaagcccagatagaagaagagaaaaaaaatgcagaaaaagaaaagcag
caacggaatcagaaaaagaaaaaggatgatgatgacgaagaaattggaggccccaaagaa
gagcttatccctgagaaactggccaaggttgaaactccattggaagaagctattaagttt
ttaacaccattgaagaacttggtgaagaacaagatagaaactcatctttttgcctttgag
atctactttaggaaagaaaagtttcttttgatgctacaatcagtaaagcgggcatttgct
attgattctagtcatccctggcttcatgagtgcatgattcgactctttcattctgtgtgt
gaaagtaaagacttacccgaaacagttagaacagtattaaaacaagaaatgaatcgtctt
tttggagcaacaaatccaaagaattttaatgaaacctttctgaaaaggaattctgattca
ttgccacatagattatcagctgccaaaatggtatattatttagattcttctagtcaaaaa
cgagcaatagagctggcgacaacacttgatggatccctcaccaacagaaaccttcagact
tgcatggaggtgttggaagccttgtgtgatggtagcctaggagactgtaaagaagctgcc
gaagcctacagagcaagttgtcataagcttttcccttatgctttggctttcatgcctcct
ggatacgaagaggatatgaagatcacagtgaacggagatagttctgcagaaacggaagaa
ctggccaatgaaatctga

DBGET integrated database retrieval system