KEGG   Mus musculus (mouse): 74890
Entry
74890             CDS       T01002                                 

Symbol
Morn3, 4930438O03Rik
Name
(RefSeq) MORN repeat containing 3
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: MORN
Other DBs
NCBI-GeneID: 74890
NCBI-ProteinID: NP_083388
MGI: 1922140
Ensembl: ENSMUSG00000029477
Vega: OTTMUSG00000026864
UniProt: Q8C5T4
Position
5; 5 F
AA seq 241 aa
MPVTKCPRKVEPPWKGWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGA
VYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCN
NQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEGIWERGMKNGHGRFFHLDH
GQLFEGYWVDNVAKCGTMIDFGRDEAPEPTQFPIPKVEILDPDGVLKEALDKLMKPEEEE
G
NT seq 726 nt   +upstreamnt  +downstreamnt
atgccggtcactaagtgtccaaggaaagtagagccgccgtggaaagggtgggaccggaaa
gcccagaagaacggactgagacaccaagtgtttgctgtgaacggcgatcactacgtgggc
gaatggaagggcaacttgaaacacgggaaaggaacacaggtctggaagaagagtggtgcg
gtctatgaaggggattggaagtttgggaagcgagatggttatggatccctcagtcatcct
gacccagagaccggaaaactcaggagagtgtattcaggctggtggaaaggcgataagaaa
tcgggctatgggatccagtttttcggacccaaggagtattacgagggtgagtggtgtaac
aaccagcgcagcgggtggggacgcatgtactacaacaacggcgacatctacgagggccag
tggcagaacgacaagcctgaaggggagggcatgttgcggctgaagaacgggaaccggtat
gagggcatctgggagagaggcatgaagaacgggcatggccgtttcttccacctggaccat
ggtcagctgtttgaaggctactgggtggacaacgtggccaagtgtggcaccatgatcgac
tttggccgtgatgaggcccctgaacccacccagttccccatacctaaggtggagattcta
gacccagatggtgtgctgaaggaagcgttggataagctgatgaagcccgaggaagaggag
ggctga

DBGET integrated database retrieval system