KEGG   Mus musculus (mouse): 74901
Entry
74901             CDS       T01002                                 

Symbol
Kbtbd11, 2900016B01Rik, 4930465M17Rik, mKIAA0711
Name
(RefSeq) kelch repeat and BTB (POZ) domain containing 11
  KO
K10476  kelch repeat and BTB domain-containing protein 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    74901 (Kbtbd11)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     74901 (Kbtbd11)
SSDB
Motif
Pfam: Kelch_6 Kelch_1 BTB Kelch_2 Kelch_3 Kelch_4 Kelch_5
Other DBs
NCBI-GeneID: 74901
NCBI-ProteinID: NP_083392
MGI: 1922151
Ensembl: ENSMUSG00000055675
Vega: OTTMUSG00000044892
UniProt: Q8BNW9 Q9CUY6
Position
8:15059408..15083333
AA seq 633 aa
MENSVAPFVLYSGTEPRTPGEDSLPLPAEEEGAASTAQTPCSLSASLCFSSGDDSPPQSR
ASAAEGSEASPPSLRSDLRVVETQWDVSSAASPESPEECARPEEPASPEDPPSRHEHARP
VELESLDELGEPVPVPPGVGSVHGEPDLVIEVAGRRLRAHKAVLAARSDYFRARASRDVL
RVQGVSFTALRLLLADAYSGRMAGVRPDNVAEVVAGARRLQLPGAAQRATEAMAPQLSLD
NCYEVLSAGKRQRLTELRDAAYRFMSDHYLEVLREPAVFGRLSGAERDLLLRRRLCTGRA
CLLAAALGTTGERSGSRPQSPSGDAESRGDAAVYCYQAEAGEWRELTRLPEGAPARGCGL
CVLFNYLFLAGGVAPAGPDGRARPSDQVYCYNPVTDSWSTVRPLRQARSQVQLLALDGHL
YAVGGECLLSVERYDPRADRWTAVAPLPRGAFAVAHEAATCNGEIYVSGGSLFYRLLKYD
PRRDEWQECPCSSSRERSADMVALDGFLYRFDLCGSRGEAQAAVGSGGGVSVFRYHCLAK
QWSQCAVHLRPPGAPAGLQPFRCVALDGTIYCVSRAGTWRFVPSQDTEAGSDMGPGGSFE
PEPLGSPLDVRGVLFPFVLNLPEKPDRGEQGAV
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggagaactcggtggcgcctttcgtcctctactcggggactgagcctaggactcctgga
gaggacagcctccctctgccagccgaggaagagggcgctgcgtccacagcgcagacaccc
tgcagtctcagcgcctcattgtgcttcagctccggggacgactccccgccgcagtctcgc
gcctctgccgcggagggctccgaagcctctccgccttctctccgcagcgacctgcgtgtg
gtggagacgcagtgggatgtcagcagcgccgcgtccccagagtccccggaggagtgcgcg
cgcccggaagagcccgcgtcgccggaggatcccccttcccgacacgagcacgcgcgtccc
gtggaactcgagtctttggacgagcttggggagcccgtgcctgtgccgcccggggtcggg
tcggtgcacggagaacccgacctggtcatcgaggtggccggtcgccgactacgggcgcat
aaggcggtgctggccgcacgcagcgactacttccgcgcgcgcgcatcccgggacgtgctg
cgggtgcaaggcgtgagcttcactgccctgcggctactgctggccgacgcatacagcggg
cgcatggcgggcgtgcggcccgacaacgtggccgaggtggtggccggcgcgcgccgcctc
cagctgcccggcgctgcgcagcgcgccaccgaggccatggcgccgcagctgagcctggac
aactgctacgaggtgctgagcgcaggcaagcggcagcggctgaccgagctgcgcgacgcc
gcctaccgcttcatgagcgaccactacctggaggtgctgcgcgagcccgccgtattcggc
cgcctgtccggtgcagaacgcgatctgctgctgcggcgccgcctgtgtaccggccgcgct
tgtctgctggccgctgcgctcgggacaaccggggagcgctctggcagtcgaccgcagagc
ccgtccggggacgcagagtcgcgcggggacgcggccgtttattgctaccaggcggaggcc
ggggagtggcgcgagctgacccggctgcccgagggcgcgccagcgcgcggctgcggcctc
tgcgtgctcttcaactacctcttcctggcgggcggtgtggctcctgcgggtcccgatggc
cgcgcgcgcccgtcggaccaggtgtattgctacaacccggtcaccgactcctggagtact
gtgcggccgctgcgccaggcacgctcgcaggtgcagctgctggccctggacggccacctg
tatgccgtgggtggcgagtgcctgctcagcgtggagcgctacgacccgcgagctgaccga
tggacggcggtggccccgcttccccgtggcgccttcgcagtggcccacgaggctgccacc
tgtaacggagagatttatgtgtccgggggctcactcttctaccgcctgctcaagtacgac
ccccggcgcgacgagtggcaggagtgcccatgcagcagcagccgagagcgctctgccgac
atggtggccctcgacggcttcctctatcgctttgacctgtgtgggagccgtggggaagct
caggctgcagtcggttcaggtggcggggtcagcgttttccgctaccattgcctggccaag
caatggagccaatgtgctgtacacctgaggccccctggcgcacccgcaggcctccagccc
tttcgttgtgttgccctggatggtaccatctactgtgtgagccgcgccgggacctggcgt
ttcgtgccttctcaggacaccgaggctggcagcgatatgggacctggtggcagctttgag
cccgagcccctgggatcccccctggatgtccggggcgtactctttccatttgtactcaac
ctgcctgagaagccggaccgcggggagcagggtgcagtctag

DBGET integrated database retrieval system