KEGG   Mus musculus (house mouse): 74919
Entry
74919             CDS       T01002                                 
Symbol
Slc35f6, 4930471M23Rik, 5730478O19Rik, ANT2BP, P40, Tango9
Name
(RefSeq) solute carrier family 35, member F6
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: SLC35F EamA Nuc_sug_transp TPT UAA PUNUT CRT-like Mg_trans_NIPA DUF4231
Other DBs
NCBI-GeneID: 74919
NCBI-ProteinID: NP_783606
MGI: 1922169
Ensembl: ENSMUSG00000029175
UniProt: Q8VE96
Position
5:30805272..30817073
AA seq 372 aa
MAWTKYQLFLAGLMLVTGSINTLSAKWADNFVAEGCGGSQEHSFKHPFVQAVGMFLGEFS
CLAAFYLLKCQGRRQSASSVEPQQPFNTLLFLPPALCDMTGTSIMYVALNMTSASSFQML
RGAVIIFTGLFSVAFLDRRLAPSQWLGILITIAGLVVVGLADLLSKHDSQHKLSEVITGD
LLIIMAQIIIAIQMVLEEKFVYKHNIHPLQAVGIEGFFGFVILSLLLVPMFYIPTASFSG
NPRGVLEDALDAFCQVGRQPLIALALLGNISSIAFFNFSGISVTKELSATTRMVLDTLRT
IVIWAFTLALGWEIFYPLQILGFLILLMGTALYNGLHRPLLAFLSRRWRLPTQEGEQERL
LGDSRTPINEAS
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcctggactaagtaccagttgttcctggccgggcttatgctggtcaccggctccatc
aacacgctttcggcaaagtgggccgacaactttgtagctgagggctgtggaggaagccag
gagcacagcttcaagcatcccttcgtccaggcagtgggcatgttcctgggagagttctcc
tgccttgctgccttctacctgctcaaatgccaaggcagaagacagtcagcctccagtgta
gagccccagcagcccttcaacaccctgcttttcctgcccccagccctgtgtgacatgact
gggaccagcatcatgtacgtggccctgaacatgaccagtgcctcaagctttcagatgctg
cggggtgcagtgatcatcttcacaggcctgttctcagtggccttcctggaccggaggctg
gcaccaagccagtggctgggcatcctgatcactattgcgggactggtggtagttggccta
gctgacctcctgagcaagcatgacagtcaacacaagctcagtgaagtcatcacaggtgac
ttgttgatcatcatggcccagatcatcattgccatccagatggtgctagaggagaagttt
gtctacaaacacaacatccacccactccaggcagtaggcatcgagggcttcttcggcttc
gtgatcctctcgctgctccttgtgcctatgttctacatccccacggcctcctttagtggg
aaccctcgcggggtgctggaagacgcgctggatgccttctgccaagtgggccgacagccc
ctgattgccctggctctgctaggcaacatcagcagcattgccttcttcaacttttcgggc
atcagcgtcaccaaggaactgagtgccaccacccgcatggtgctagacaccctgcgcacc
atagtcatctgggcctttaccctcgcactgggctgggagatcttctatccattgcagatc
cttggtttcctcatcctccttatgggcaccgccctctacaatgggctgcaccgaccactg
ctagccttcctgtccagacgctggcgactccctacccaggagggagagcaagagagactg
ctaggtgacagtcggactcccatcaatgaagccagctga

DBGET integrated database retrieval system