KEGG   Mus musculus (mouse): 74978
Entry
74978             CDS       T01002                                 

Gene name
Lrriq1, 4930503E15Rik, Gm1557
Definition
(RefSeq) leucine-rich repeats and IQ motif containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: LRR_4 LRR_8 IQ LRR_9 LRR_6
Other DBs
NCBI-GeneID: 74978
NCBI-ProteinID: NP_001157031
MGI: 1922228
Ensembl: ENSMUSG00000019892
Vega: OTTMUSG00000032477
UniProt: Q0P5X1
Position
10; 10 D1
AA seq 1673 aa
MEDSDDSEAKLREEIEAELDKISISSLENDEVENDSVSDTQSDSSDTDLLELPESVLHYI
NVIKNKSKTAEELILQDVEDTDIFSDYKKGCNHGTVTDSHMHLRTGSLPESKANAEQLMK
ILSVIEKEEFMRSLAPSARCVSVREIITPDTPMDEYILPDEADLSFGYFEVEERCRKSFE
AWQDKQQELEEKDKETLEAQNEREKRTFQEEDEKRQCWMRQFEVEKKHLEDLQKQDQDKM
NDELHKEEKIWKEKYRQHEEHIRNLHLKMEEERTRLSELQEKEKARLFKLRYDAAVKIQA
TYRASVTYRKYSPIIKEQMEKKRRRAQELKEKEAKIRQKEEEKRRRLEEEQRVEEEKKKK
MLEERRRREREYEEKKSILRQEREEQRSKEVIRLREHAHSPLIITCALKKGDCHGKQQAI
AHVPKGKGTIAKESVDSNSKKQEDACLAQQLNKRENTHVQQLAMKKSTGIKLKPNQAILV
ELKMNEKNESLPKLKINENLSKNQCSEQPSDQEFNAENVDQKNELENSNLKESVNEQYPW
QGLESDTQTEEHVEHVREEKVGQETEKLFGFNQEVSAEDSKQAQGVMEETREGLAEEIEI
KEMTQQGGPSDENNSSPISMQKSLPSLTPDNPEPVERSVTLEEDQETDLKSERIEEIPEE
GVLSCDAAVINADASVHTEGEADLQDSASGKLAPSEEAGSHSANNLLATEEVEDSPKSEI
QEALEKGQQTKAEADGVLTCSVSQLTVLSSVEERRLAWVKTFKPWAEIFEQNQHKKIVKK
RRLVKCPPNTMPPLDPSAILQYGPWKSLKQVPVITFQGLPGCSLSTLAECSNLQILSLRR
CGLTSLQGLSHCTRLKYIDAQENHIEAISCENLENLSVVLLNNNLLTSIHGFDGCTNLQS
LELSHNKITRISGLESLKYLQELTVDHNQLISTKGLCEAPTIVYLDCSHNHLTGIDGIGN
CGLLQIIKLQGNYLREPPSLRNHVLLRELHLDDNSISSVEGLSSCWLPLLQYLSISQNSL
ATIVPLFHLVSLEKLDVSNNCLSDLTNVMCWFNACYSLRELCLTGNPVLQEINWRDSILK
TLPALRVLNGDMLNSYANDRIEEHYHQDLRCLLALCQYQLQEFNLLPEKYITQKRDILTL
HAVDRLSQYYKDLMKLSHECRRAHEQGDVNTTERSAAETNKNHPDFSNTDSALQNKTLHA
QTNSCEADSPATSPNPLDTVFRPSTSHCEELRGRNQEKLMAHKSEQSRISSRSNSRASFI
EMKMADSPMSNHHNAERSSPTKAAMVIQAQWRSYIAHRQINCSAEMHPTTTEPLQDPLIN
NQTTSNEERRKTNMDIQEQREKAALHIQAVWKGFILRKKLATARKAIKDEESGEEYEEID
LEDFEFDEDALEKDWPALDSTGFPSQTLPLSNQLPWPKNSRTLRHDETSPTIPVRPAQAW
LCNEKENVMSSEYTQLSSRSESGILSWTPDSKTSRKNLLQSEKEEKISEEWGFKDISTAQ
QMLKRAKKMKSKKLRKKLEPSVRLALFKKAKNKVSVTKSSKKTQLRRDNYFEAHISSQDE
EEEAVSKATAAKEKLERSQEYTYQWLHTQVGFPEATSSRNLKCNHFLPELDPDVLNGGRV
QLVARLVSREDTDLDLFSMTSASALSVNKDKKSQTHRYSTGSSSKLWFPSELI
NT seq 5022 nt   +upstreamnt  +downstreamnt
atggaggacagtgacgacagcgaggcaaagctcagagaagaaatcgaagctgaattggat
aaaatcagcatctcttccttggaaaatgatgaggttgaaaatgattcagtgtcagacaca
cagagtgacagtagtgacactgatttgcttgaattgccagagtcagttcttcattatatc
aacgtcataaagaacaagagtaaaactgctgaagaactcattcttcaagacgtagaagat
actgatatcttcagtgattataagaaaggttgtaaccatggcacagtgactgacagtcac
atgcatttgaggactgggtcattgccggaatctaaagcaaatgctgagcaattaatgaag
atattatctgtaatagaaaaggaagaatttatgagaagtctagctccttctgccaggtgt
gtttccgttcgtgagattattactcctgacacacccatggatgaatatattttaccagat
gaggctgatttgagtttcggatactttgaagtagaagaaagatgtagaaaatcttttgaa
gcttggcaggacaaacaacaagaactagaagaaaaggataaagaaactctggaagctcag
aatgaaagagaaaagcggacctttcaagaggaagacgagaagagacagtgctggatgaga
cagtttgaagttgaaaagaaacacttagaggatcttcagaagcaagaccaagacaaaatg
aatgatgaactccataaagaagagaaaatatggaaagaaaaatacagacagcatgaggaa
catatcagaaacttgcacttaaaaatggaggaggagagaacaagattaagtgagctacaa
gaaaaagaaaaggcacgtttattcaaactgcggtatgatgcagctgtaaaaattcaagcc
acttatagagcatcagtaacttaccgaaaatatagcccaatcataaaagagcaaatggaa
aagaagaggaggagagcacaggagttgaaagagaaggaggcaaagatacgacagaaggag
gaagaaaagaggaggagacttgaagaggagcagagggtagaggaggagaagaagaagaag
atgctggaggagaggaggagacgagagagggaatacgaagagaaaaagagcatcctgaga
caagagagagaagagcaacgaagcaaggaagtgataagactgagggaacatgcccactcg
ccactgatcattacctgtgctttaaagaaaggagattgccatggcaagcagcaagctatt
gcacatgtgccaaagggtaagggtactatagccaaagagtcagtggacagcaactcaaag
aagcaagaagatgcttgcctcgctcagcaattaaacaagagagaaaacacacacgtgcag
cagcttgcgatgaagaaatcaacaggaataaaattaaaaccaaaccaggcaattttggta
gaattaaaaatgaacgagaaaaatgaaagtttaccaaaattaaaaatcaatgaaaactta
tcaaaaaaccaatgttcagaacaaccttctgaccaagaatttaacgctgaaaatgtagac
caaaaaaatgaattggaaaactccaacctaaaggaaagtgtgaatgaacagtacccgtgg
caaggactagagtcagatactcagacagaggaacatgtggagcatgtcagggaggagaag
gtgggacaagaaaccgaaaaactatttggattcaatcaagaagtgagtgcagaagacagt
aaacaagcacaaggagtcatggaggagacccgggagggattggctgaagagatagaaatc
aaagagatgacacagcaaggtgggccatcggatgagaataatagctcacctatttccatg
cagaaaagcctaccatcactgacaccagacaatcctgaacctgtagaaagaagtgtaaca
ctagaagaagaccaagagactgatttaaaatcagaaagaattgaggaaatcccagaagaa
ggtgtgctgtcctgtgatgctgcagtcattaacgcagatgcctctgtgcatacagaaggc
gaggcagacctgcaggattctgcctcaggcaagcttgctcccagtgaagaagctggtagt
cacagtgctaataacctcttggccactgaagaagtggaagactctcctaaatctgaaatt
caagaagctctggaaaaaggacagcagacaaaggctgaagctgatggtgtcctgacttgc
tctgtttcacagttaacagttttatcttcagttgaggaaaggagactagcttgggtaaaa
acatttaaaccctgggctgaaatctttgagcaaaatcaacataagaaaattgttaaaaaa
aggagacttgtgaagtgcccaccaaatacaatgcctcctttagatccatcagccattctc
cagtatggcccttggaaatctttaaagcaggttccagtgattacatttcagggtttgcct
ggttgtagtctctctacactggcagagtgctcaaatcttcagatcctgtctctccgacgc
tgtggattaacttccttgcagggactgagccactgcacacgccttaagtacatcgatgca
caggaaaaccacattgaagctatcagttgtgaaaatttggaaaatctctctgttgttctt
cttaataataatctgctgacttctattcatggttttgatggatgcactaatctccaaagc
cttgaactctcacataataaaatcactcgaatcagtggtttagaatctttgaaatatctt
caagaactaactgtggaccacaatcagttaattagcactaaaggtctttgtgaagcaccc
accatcgtgtacctggattgctcacataaccatcttactggcattgacggcattggaaat
tgtggattgctccagataataaagctgcagggaaattacctaagagagcctccgtcctta
agaaatcatgttctgctcagagagctgcatttggatgacaacagcatctcaagtgtggaa
ggactttcttcttgttggttgcctttactacagtatctaagcatttcacaaaacagctta
gccacaattgtgccactttttcatcttgtctctttggagaagctggatgtcagcaacaat
tgtctttctgatctgacaaatgtcatgtgttggttcaatgcatgctactctctccgtgag
ctttgtctcactggaaacccagtactccaggaaataaactggagagattctatacttaaa
acattacctgctctgagagtcctcaacggtgacatgctgaactcttacgccaatgaccgt
attgaagagcactatcatcaagacttaagatgtttgttggcactttgtcagtaccagctt
caagagttcaacttattacctgaaaagtatatcacacagaagagggacattctcactctg
catgctgtagacagactctcacagtactataaagacttaatgaaactcagtcatgaatgc
agacgtgcacatgaacaaggggatgtcaataccactgagaggtctgcagcagaaaccaac
aaaaaccatccagacttctcaaacactgacagcgcactgcaaaacaagacccttcatgcc
cagactaacagttgtgaggccgattcaccagccacttctccaaacccgttggacactgtc
ttcagaccttctacatcacactgtgaagaactgagaggaagaaatcaggaaaagcttatg
gcgcacaagagtgagcagagtaggatcagtagtcgctccaacagcagagcctcattcata
gaaatgaagatggcagattctccaatgagtaatcatcacaatgctgaacgaagttcacca
accaaggcagctatggtaatccaagcacaatggcgtagttacattgcacacagacagatt
aattgctctgcagaaatgcatcctaccacaacagaacccctgcaagatcccctcatcaat
aaccagactacttctaatgaagaaagaagaaaaactaatatggatatccaagaacagagg
gagaaggctgctcttcatattcaggcagtttggaagggctttattttacgaaagaagctg
gcgaccgcccgaaaggctatcaaagatgaggaatctggagaagagtatgaagaaattgat
ttagaggattttgaatttgatgaggatgccttggagaaagactggccagctttagattct
actggcttcccttcacaaacactgcctctctccaaccagctgccctggccaaagaactct
cggactttgagacatgacgaaacttcacctaccataccagttcgtccagctcaggcatgg
ctgtgcaatgagaaagaaaatgtgatgtcgtccgagtacacacagttaagcagcagatca
gaaagcggaattttatcctggacacctgactcaaaaacaagtaggaagaatttactacaa
tctgaaaaggaagaaaaaatttcagaagaatggggctttaaggatatctctacagctcag
caaatgctaaagagagcaaagaaaatgaaatcaaagaaattaaggaagaaattagaacct
tctgtgcgactagcattattcaaaaaagccaaaaataaagtttctgttacaaagtcatca
aagaagacacagctcagaagagacaattactttgaagcacacatctcttcccaagatgag
gaggaagaggcagtctccaaggcaactgctgcaaaggaaaagttagaacggagtcaggag
tacacctaccagtggcttcatacacaagttggctttcctgaagcaaccagttccaggaac
ctgaaatgcaatcactttttgcctgagttagatccagatgtacttaatggtggaagagtt
caacttgtggcaaggcttgtaagcagagaagacacggatttagaccttttttccatgacc
agtgcaagtgctttgtctgtgaacaaagacaaaaagagccagacacacagatactcgact
ggatcctcaagtaagctatggtttccttcagagctaatttag

DBGET integrated database retrieval system