KEGG   Mus musculus (house mouse): 74998
Entry
74998             CDS       T01002                                 
Symbol
Rab11fip2, 4930470G04Rik, A830046J09Rik, AW558126, Nrip11
Name
(RefSeq) RAB11 family interacting protein 2 (class I)
  KO
K12484  Rab11 family-interacting protein 1/2/5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    74998 (Rab11fip2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74998 (Rab11fip2)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    74998 (Rab11fip2)
SSDB
Motif
Pfam: C2 RBD-FIP
Other DBs
NCBI-GeneID: 74998
NCBI-ProteinID: NP_001028344
MGI: 1922248
Ensembl: ENSMUSG00000040022
UniProt: G3XA57
Position
19:complement(59881934..59933086)
AA seq 529 aa
MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVW
KEEASFELPGLLMQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
RLESKQGKRIKNRGEIKVNIQFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKSDGVF
SDTSSAIVPSTHMPDANPEFSSGEMQMKSKPKKPFLLGPQRLSSAHSMSDLTGSHLSSEK
LKSSTVGPTHLLSRQIDSFGVVPESGSLKSPHRRTLSFDTSKLNQPGSIVDEGEHSFGRQ
SDPFTNVTASLPQKFATLPRKKNPFEESSEPWDSSMNLFSKPIEVRKESKREKREKVSLF
ERVTGKRDSRRPDKLNNGGSDSPCDLKSPSAFSENRQDYFEYESTNPFTAKFRASTIMPS
SSFHVNPTSSEDLRKIPDNNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDY
IDNLLVRVMEETPSILRVPYEPSRKAVYTQDHLSPGPPHLCGEATSTHS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgatgctgtctgagcaagcccaaaagtggtttccaacccacgtgcaggtcacagtgctc
caagctaaagatctgaagccaaaaggcaaaagtggtaccaatgacacatacaccataatt
cagttgggcaaagagaagtattctacatctgtagcagagaaaaccctggagccggtctgg
aaggaggaggcctcctttgagctgcctgggttgctcatgcagggtagtccggagaaatac
attctttttcttatagtgatgcacaggtccctggtgggactggataagtttttagggcag
gtggcaatcaatctcaatgacatctttgaggacaaacaaagaaggaaaacagagtggttt
agattagaatccaaacaaggaaaaagaataaaaaacaggggtgagataaaggtcaatatt
caatttatgaggaacaacatgacagcaagcatgtttgacttgtcaatgaaggacaagacg
agatcaccttttgcaaaattaaaagataagatgaaagggaggaaaagcgacggggtgttt
tctgatacgtcctctgccatcgttccgagcactcacatgcctgatgccaatcctgagttt
tcaagtggtgaaatgcagatgaaatccaaaccaaaaaagccttttcttttgggtcctcag
cggctctcttctgcccattcgatgtctgatttaactgggtcccacttatcttctgagaag
ctgaagtccagcactgtgggtccaacacatcttctcagtcgccagatagattcctttgga
gttgttccagaaagtggaagtctcaagtctccacacagacgaacactaagctttgatact
tctaaattgaaccaacctggcagcattgtggatgaaggtgaacactcttttggaagacag
agtgacccatttacaaatgtgactgcttcattaccccaaaaatttgcaacactgccaagg
aagaagaatccatttgaagaaagcagtgagccatgggacagcagcatgaatttattctca
aaaccaattgaagtcaggaaagaaagtaagagagagaaaagggagaaggtgagcctcttt
gaaagagtgactggcaagagagatagcaggagacctgacaagctgaacaatggtggatct
gatagcccatgtgacttgaaatcacctagtgcttttagtgaaaaccggcaggactatttt
gaatatgagtcaactaacccgtttacagcaaaattcagggcttcaactataatgccatct
tcaagttttcatgtgaatccaacaagcagtgaagacctcaggaaaatcccggacaacaat
cctttcgatgccacggctgggtaccggagtctgacctacgaagaggtgctgcaggagctg
gtgaagcacaaagaactccttcggaggaaggacacccatatccgggagctagaggactac
attgacaacctcctcgtcagggtgatggaagagacacccagcatcctgcgagtgccctac
gagccatccagaaaagctgtatacacccaggaccacttgtcacccgggccaccccacctc
tgtggagaagctacttcaacccactcctga

DBGET integrated database retrieval system