KEGG   Mus musculus (mouse): 75013Help
Entry
75013             CDS       T01002                                 

Gene name
Ct55, 4930502E18Rik
Definition
(RefSeq) cancer/testis antigen 55
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: S1-like
Motif
Other DBs
NCBI-GeneID: 75013
NCBI-ProteinID: NP_083418
MGI: 1922263
Ensembl: ENSMUSG00000055555
Vega: OTTMUSG00000017384
UniProt: Q14BQ3
Position
X; X A5
AA seq 236 aa AA seqDB search
MHRLISRLRAFFQRKADPKEAKEERQKLLEDATSLQNKQGVVAGSCSNYDCMTKHTRSSA
DVETGDNPLKAEPNLPAAVEEQSPRGLNAVTVDNDHDEEPSESHMRILLASITSLVGDAD
YNGHGFSFSLDIACKDFKPYNGDLVEIEFSDEQDTQSRRAILVKPLKHCHLNEVRVTRTD
GSTGVLEDTIFFTLDSLKLPSGYVPQPDDVVNVVAVQSMQSNYFWRAVAMTPVQVL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggctaatttccagacttcgtgccttctttcaaaggaaagcagacccgaaggag
gccaaagaagagcggcagaagctcttggaagatgctacctcactacaaaacaaacaggga
gttgtggcagggtcctgtagtaactatgactgcatgactaagcacacccgctccagtgct
gacgttgagactggcgacaatcctctgaaagctgagccaaaccttcctgcagctgtggaa
gaacaaagccctcgtggattgaacgcagtcacagtggataatgaccatgatgaagaaccc
tcagaatctcacatgagaattttgcttgcctctatcacctctctagtgggtgatgctgac
tacaatggtcacggattttccttctctctagacattgcttgtaaagatttcaaaccttat
aatggtgacctggtagaaattgaattttctgatgagcaagacacccagagcagaagggcc
atcttggtgaagcctctgaaacattgccatttaaatgaggtccgtgttaccagaacagat
ggaagcactggggtgttggaagacaccatctttttcaccttggattctcttaaacttcct
tctggatatgtgccgcaaccagatgatgttgtcaatgtggttgcagtgcagagcatgcaa
tccaactatttctggagagcagttgcaatgaccccagtacaagtattgtag

DBGET integrated database retrieval system