KEGG   Mus musculus (house mouse): 75029
Entry
75029             CDS       T01002                                 
Symbol
Purg, 4930486B15Rik
Name
(RefSeq) purine-rich element binding protein G
  KO
K21800  purine-rich element-binding protein gamma
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    75029 (Purg)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    75029 (Purg)
SSDB
Motif
Pfam: PurA
Other DBs
NCBI-GeneID: 75029
NCBI-ProteinID: NP_690034
MGI: 1922279
Ensembl: ENSMUSG00000049184
UniProt: Q8R4E6
Position
8:33875650..33907500
AA seq 350 aa
MERARRRGGGGSGGGRGRGGKNVGGPGLSKSRLYPQAQHSHYPHYSASATPNQSGGTSEI
QELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKD
CLGDFIEHYAHLGLKGHRQEHGQSKEQVSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIE
RDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQDQTIVLPAQGMIEFRDALV
QLIEDYGEGDIEERRCGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYR
NTITVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRRASGEEQECLD
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggaaagagccaggcgaaggggaggcggcggcagcggcggcggccgtggccgcggaggc
aagaatgtagggggccctggcctaagcaagagtagactctatccccaggcccagcattct
cactacccccactactccgcgtcagccacccctaatcagtctgggggcacatccgaaatc
caggagctagcctccaaacgtgtggacatccagaaaaagaggttttacctagacgtgaag
cagagctcccggggccgcttcctaaagatagccgaagtctggatagggagaggccggcag
gacaatatcagaaagagtaaactgaccctctccctgtcggtagcagcagagctgaaggac
tgtctaggcgacttcatcgagcactatgcccatctgggcctgaaaggccacagacaggag
catggccagagcaaagagcaagtctccaggaggcggcagaagcactctgcaccctcccca
ccggtgtcagtggggtcagaagagcatcctcacagtgtcctcaaaacggactatatagag
agggacaataggaaatactacctggacctaaaggaaaaccaacgaggtcgcttcctaagg
attagacaaaccatgatgcggggcactggcatgatcggttactttggccacagtttgggc
caggatcagactattgtcctcccagcacaaggtatgattgaatttcgtgatgccttggtt
cagctgattgaagactacggcgaaggagacatagaagaacgaaggtgtggagacgacgac
ccacttgaactcccagaggggacctctttcagagtggacaataaaaggttctactttgat
gtgggctctaataaatatggaattttcctgaaggtaagtgaggtgagaccgccttaccgt
aatactattactgttccgttcaaagcttggacaaggtttggggagaattttatcaagtat
gaagaagagatgaggaaaatttgcaacagccataaggaaaagagaatggatggccgtcgg
gccagtggtgaagaacaagaatgcctggactag

DBGET integrated database retrieval system