KEGG   Mus musculus (mouse): 75062Help
Entry
75062             CDS       T01002                                 

Gene name
Sf3a3, 4930512K19Rik, 60kDa
Definition
(RefSeq) splicing factor 3a, subunit 3
  KO
K12827  splicing factor 3A subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    75062 (Sf3a3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    75062 (Sf3a3)
Spliceosome [BR:mmu03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    75062 (Sf3a3)
 Complex B
    75062 (Sf3a3)
 Complex C
   U2 SnRNP specific factors
    75062 (Sf3a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3449 Telomere_Sde2_2 SF3A3 SF3a60_bindingd
Motif
Other DBs
NCBI-GeneID: 75062
NCBI-ProteinID: NP_083433
MGI: 1922312
Ensembl: ENSMUSG00000028902
Vega: OTTMUSG00000009168
UniProt: Q9D554 Q58E59
Position
4; 4 D2.2
AA seq 501 aa AA seqDB search
METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDL
YDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENP
SEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNA
EYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQTDFEKKWDNGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSL
FAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRQLTHENVQRKQARTGEEREEEE
EEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPK
AFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggagacaattttagagcagcaacggcgctatcatgaggagaaggaacggcttatggat
gttatggccaaagagatgcttacgaagaagtccacgcttcgggaccagatcaattccgat
caccgcactcgggccatgcaagataggtacatggaggtcagtgggaacctgagggatttg
tatgatgataaggacggactgcggaaggaggagctcaatgctatctcaggacccaacgag
ttcgctgaattctataacagactcaagcagataaaggaattccatcggaagcacccaaat
gagatctgtgtgccaatgtcagtggaatttgaggagctgctgaaggctcgagagaatcca
agtgaagaggcacaaaacttggtggagttcacagatgaagagggatatggtcgctacctt
gatctccatgactgctacctcaaatacattaacctgaaggcatctgagaagctggattac
atcacatacctgtccatctttgaccagttgtttgacattcctaaagaaagaaagaatgca
gagtacaaaagatacctggagatgctgctggagtacctacaggattacacagatagagtg
aagccccttcaggatcagaacgagctctttgggaagattcagaccgactttgagaagaag
tgggataatggcacctttcctggatggccgaaagagacaagcagcgccctgactcacgcg
ggagcccatcttgatctctccgcattctcctcctgggaggagttggcatccctgggtctg
gataggttgaaatctgcactattggcattgggcctgaagtgtggcgggaccctagaagaa
cgagctcagaggctcttcagcaccaaaggaaagtctttggagtcactcgacacttctctg
tttgccaaaaatcccaagtcaaagggcacaaaaagagacactgagaggaacaaagacatt
gctttcctggaagcccagatctatgaatacgtggagattctcggggaacagcgacagctc
actcatgaaaatgttcagcgcaagcaagccaggacaggcgaggagcgggaggaggaggag
gaggagcagatcagcgagagcgaaagtgaggacgaagagaatgagatcatttacaacccc
aagaacctgccgctgggctgggacggcaagcccatcccctactggctgtacaagctccac
ggcctgaatatcaactacaactgtgagatctgtgggaactacacctaccgagggcccaag
gccttccagcggcactttgcggagtggcgtcatgctcatggcatgaggtgtttgggcatc
ccaaacactgcccactttgcaaatgtgacacagattgaagatgctgtctccttgtgggcc
aagctgaaactgcagaaggcttcagaacggtggcagcctgacaccgaggaagaatatgaa
gactccagtggaaatgttgtgaacaagaagacatacgaggatctgaaaagacaagggctg
ctctag

DBGET integrated database retrieval system