KEGG   Mus musculus (mouse): 75064
Entry
75064             CDS       T01002                                 

Gene name
Zcchc13, 4930513O09Rik, Cnbp2
Definition
(RefSeq) zinc finger, CCHC domain containing 13
  KO
K09250  cellular nucleic acid-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    75064 (Zcchc13)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Zinc fingers of alternating composition
    75064 (Zcchc13)
SSDB
Motif
Pfam: zf-CCHC zf-CCHC_4 zf-CCHC_5 zf-CCHC_3 zf-CCHC_2 zf-CCHC_6
Other DBs
NCBI-GeneID: 75064
NCBI-ProteinID: NP_083434
MGI: 1922314
Ensembl: ENSMUSG00000031330
Vega: OTTMUSG00000018343
UniProt: Q9D548
Position
X D; X 46.26 cM
AA seq 170 aa
MSSKSCFKCGHSGHWARECPKGGTRGRTARGRTRGPQCSTANQSDVCYRCGETGHYAKDC
DLLQDTCYNCGRRGHIAKDCTQAKREREQCCYICSQPGHLARDCNRQEEQKCYTCGEFGH
IQKDCTQIKCYRCGENGHMAVNCSKTSEVSCYRCGESGHLARECPIEATA
NT seq 513 nt   +upstreamnt  +downstreamnt
atgagcagtaaaagttgcttcaagtgtggacactctggccactgggcccgggagtgtcct
aagggaggaacccgagggcgaacagcaagaggtcgtaccagaggtccccagtgcagcacc
gccaaccagtccgatgtttgttatcgctgtggtgaaactggtcactacgccaaggactgt
gatcttctccaggatacctgctacaactgcgggagaagaggacacatagctaaggactgt
acccaggctaaacgagagagggagcagtgctgttacatctgcagtcagcctggtcatctg
gctcgggactgcaaccggcaagaagaacagaaatgctacacttgtggtgaatttgggcac
atccagaaagattgtacccaaattaagtgctacagatgtggtgagaatggccacatggcg
gtgaactgcagcaagacgagcgaagtcagctgctaccgctgtggagagtctggacatctg
gctcgggaatgccccattgaggctaccgcttag

DBGET integrated database retrieval system