KEGG   Mus musculus (mouse): 75083
Entry
75083             CDS       T01002                                 

Gene name
Usp50, 1700086G18Rik, 4930511O11Rik
Definition
(RefSeq) ubiquitin specific peptidase 50
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: UCH UCH_1 RNase_H_2
Other DBs
NCBI-GeneID: 75083
NCBI-ProteinID: NP_083439
MGI: 1922333
Ensembl: ENSMUSG00000027364
Vega: OTTMUSG00000015955
UniProt: Q6P8X6
Position
2; 2 F1
AA seq 390 aa
MCFIDMASHRPVPADDFGAYYNLAECADYDSLPESKTQPHFQGVTGLRNLGNTCYMNAIL
QCLCSVSPLVEYFLSGKYITALKKDCSEVTTAFAYLMTDMWLGDSDCVSPEIFLSAVGSL
YPAFLKKTQQDAQEFLIYVLNELHEALKKHCRRRVNEKRTGQSCCRKVPAQETSIITRLF
EGQLSYSITCLKCESCTHKNEVFTILSLPIPSDYECSLQDCLQCFFQQDTLTWSNQIYCS
FCEIKQEAAVRTTISKVPKIIVFHFKRFDIQGTVKRKLRTDIHYPLTNLDLTPYICPVFR
KHPMYNLCAVVNHFGDLDGGHYTAFCKNSVTQAWYSFDDTRVSEIPDTSVQTATAYLLFY
SCQPFSIPAQKRKSQDSTPDHCKQAIRKWP
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgtgcttcattgacatggcgtctcatcggccggtccctgcagacgacttcggtgcctac
tacaaccttgcggagtgtgcagactatgactccctgccggagtctaagacccagccacac
ttccagggcgtgacgggactgcggaacctgggcaacacctgctacatgaacgccatcttg
caatgcctctgcagcgtatctccactggtggagtacttcctgtccggaaagtacatcaca
gctcttaagaaggactgcagtgaggttaccaccgcctttgcctacctgatgacagatatg
tggcttggggactcagactgtgtctcaccagagatatttctgtcggctgttggcagtctt
tacccagcttttctgaaaaagacacagcaagatgcgcaggagttcctgatttacgtcctc
aacgagcttcacgaagctttgaaaaagcactgccgaagaagagtgaatgagaaaagaaca
ggccaaagctgctgcaggaaggtgccggcccaggagacctccatcatcacccggctgttt
gaaggacagctcagttacagcatcacatgtttaaagtgtgagagctgcacgcacaagaac
gaagttttcaccatcctctccctccccatcccatctgactatgaatgttccctccaggac
tgtctccagtgttttttccaacaggacacactgacctggagcaaccaaatctattgttcc
ttttgtgaaatcaagcaagaggcagctgtgaggaccacgatttccaaggtgccgaaaata
attgtttttcactttaaaaggtttgacatccagggcacagtaaagaggaagctgcggaca
gacatccattaccccctgaccaacctggacctcactccttatatctgtccagttttccgg
aaacatcccatgtacaacctgtgcgcagtggtgaaccactttggagatctggatggtggt
cactacactgctttctgcaagaactcggtaactcaggcctggtacagctttgatgacacc
cgagtcagtgagatcccagatacttctgttcaaacagctacagcctatcttctgttctat
agctgccagcctttttctataccagcacagaaacgcaagagccaggacagtactcctgac
cactgcaagcaagctatccgaaagtggccgtga

DBGET integrated database retrieval system