KEGG   Mus musculus (mouse): 75087Help
Entry
75087             CDS       T01002                                 

Gene name
4930505A04Rik
Definition
(RefSeq) RIKEN cDNA 4930505A04 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: GDWWSH
Motif
Other DBs
NCBI-GeneID: 75087
NCBI-ProteinID: NP_001093864
MGI: 1922337
Ensembl: ENSMUSG00000040919
Vega: OTTMUSG00000005342
UniProt: Q5SPV6
Position
11; 11 A4
AA seq 233 aa AA seqDB search
MEGEEKQQQHKTEDDGIACVAERKVEIKNEKSPGKSTQHPKPCVDRRRVNYAKFIHTNAR
TYNEPVPYIDNKGPEKQRKWWFHNEAPKHVSQPSYDTKSVQRSDFQKPACPLVLPVKHSR
MQKPSCGIVPLTSLDVSGEHENNFVEYISFIHQYDARRTPNEPIKGKKHGTFVQREIKLG
AMPIVPKAPEVLLNTLESGSSEQPQKTDKGNSSGDKVTSPGLCQQNSQELLET
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggagggagaggagaagcagcaacagcataaaacagaagatgatggtatagcgtgtgta
gctgaaagaaaagtagaaatcaaaaatgaaaaaagtcctgggaaaagcacacaacaccca
aaaccatgtgtggacagaagacgtgtaaattatgctaaattcatacacacaaatgcaaga
acatacaacgagccagttccctacattgataataaagggccagaaaagcagagaaaatgg
tggttccataatgaagcaccaaaacatgtctcccaaccatcttatgacaccaaaagtgtc
cagcggagtgacttccagaagccagcatgcccattggttttgccagtcaaacacagccgg
atgcaaaagccttcttgtggaatagttccacttaccagtctggatgtatcaggagaacat
gagaacaattttgtagaatacatctcttttatacatcaatatgatgccaggagaactccc
aatgaacccatcaaaggaaagaaacatggaaccttcgtgcagagagagataaaactaggg
gctatgccaatagttcctaaggcaccggaggtattattgaacactctagagtcaggttca
tcagaacagccccaaaaaacagacaaaggaaattcatcaggagacaaagtgacctcacca
ggcctatgccaacagaattcccaagagttgctggagacttag

DBGET integrated database retrieval system