KEGG   Mus musculus (mouse): 75210Help
Entry
75210             CDS       T01002                                 

Gene name
Prr3, 4930540G07Rik, Cat56
Definition
(RefSeq) proline-rich polypeptide 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH zf-CCCH_4
Motif
Other DBs
NCBI-GeneID: 75210
NCBI-ProteinID: NP_663462
MGI: 1922460
Ensembl: ENSMUSG00000038500
Vega: OTTMUSG00000037219
UniProt: Q811B5
Position
17; 17 B1
AA seq 190 aa AA seqDB search
MPKRKKQDQPPPLPQQQQHLALSERDEPGDEEDERPMGPPSLLGPPPMANGKPGDPKSAF
HRGPPGSRGRMIPPLLSLPPPPRGRGYIRGGLGPRSSPYGRGWWGINAEPPFPGPGHGGP
SRESFYKEARNPRRLRSWSLVKNTYPPKDSPQMMEDKSDRPVCRHFSKKGHCRYEDHCAF
YHPGVNGPPL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaacgaaagaagcaggaccagccgccgccgctgccgcagcagcagcaacatctc
gcactgtctgagcgggacgagcctggagatgaggaggatgagcgccccatgggaccaccc
agccttctgggccctccccccatggctaacgggaagcctggtgatcccaagtcagctttc
cacaggggtcctccaggatcaaggggacggatgattcccccactgctgagtctcccgcct
cctccccggggtagaggctacattcggggaggcctcggtcctcgatctagcccgtatggt
cgtggttggtggggtatcaatgccgaacctccttttcctgggccaggccatgggggtccc
tctagggaaagcttttacaaagaggcgagaaacccacgaaggctcagaagctggtctctt
gtcaagaatacctacccacccaaggacagcccccagatgatggaagacaagtctgaccgc
cctgtctgccgacacttttctaagaagggccactgtcgatatgaagaccattgtgccttc
taccatccaggcgtcaacggacctcctctgtga

DBGET integrated database retrieval system