KEGG   Mus musculus (mouse): 75221
Entry
75221             CDS       T01002                                 

Symbol
Dpp3, 4930533O14Rik, C86324, DPP_III
Name
(RefSeq) dipeptidylpeptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    75221 (Dpp3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     75221 (Dpp3)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   75221 (Dpp3)
SSDB
Motif
Pfam: Peptidase_M49
Other DBs
NCBI-GeneID: 75221
NCBI-ProteinID: NP_598564
MGI: 1922471
Ensembl: ENSMUSG00000063904
UniProt: Q99KK7 Q3UDF3
Position
19:complement(4957257..4978315)
AA seq 738 aa
MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIY
ALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPK
DKLGRVILGSKAAQQRPEEVRDLWQTCGDLMFSLEPRLRHLGLGKEGVTTYFSGDCTMED
AKLAQDFLDSQNLSAYNTRLFKVVGQEGKSHYEVRLASVLNTDPALDSELTSKLKRYEFQ
GNHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQYVESFTQGSIEAHKRGSRFW
IQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMSAKFERLVASAEQLLKELPWP
LAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYAAK
REKLTFLEEEDKDLYIRWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDKETVINPE
TGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLNPQVLEIFGFEGADAEDVIY
VNWLNMVRAGLLALEFYTPEAANWRQAHMQARFVILRVLLEAGEGLVTVTPTTGSDGRPD
ARVRLDRSKIRSVGRPALERFLRRLQVLKSTGDVVAGRALYEGYAAVTDAPPECFLTLRD
TVLLRKESRKLIVQPNTRLEGSEVQLVEYEASAAGLIRSFCERFPEDGPELEEVLIQLAA
ADARFWRNQAQEAPPGQA
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggcagatacccagtacatcctgcccaatgacattggtgtgtctagcctggactgcagg
gaggcattccgcctgctgtcacccacagagcgcctctatgcccatcacctgtctagagct
gcttggtatgggggcctggcagtgctgctccagacatcccctgaagccccctacatctat
gccctgcttagccgcctcttccgtgcccaggaccctgaccagctgcgccaacatgccctg
gctgagggtcttactgaagaagagtaccaggcattcctggtctacgctgcaggggtctac
tccaacatgggcaactacaagtcctttggtgacaccaagtttgttcctaacctgcccaag
gacaagctgggacgtgtgatcctggggagtaaggctgcccagcagcggccagaagaagtc
agggacctttggcagacctgtggggaccttatgttctccctggaaccgaggcttcgacat
cttgggctggggaaggagggagtcaccacctatttctctggggattgtaccatggaagat
gctaagctggcccaggactttctggactctcagaacctcagtgcatacaacactcggctc
ttcaaggtcgttggccaggaagggaagtcccactatgaggtgcggctggcttcagtcctc
aacacagaccctgctctcgactctgaattgacctccaagctgaagagatatgagttccag
gggaaccatttccaggtcacccggggggactatgcccccatcctccagaaggtggtagaa
cacttggagaaagctaaggcttatgcagccaacagccaccaggagcaaatgctggctcag
tacgtggagagcttcacccagggctccattgaggcccataagaggggctcccgcttctgg
attcaggacaaaggccccattgtagagagttacattggcttcattgagagctaccgtgac
ccctttggctcccgaggagagtttgaaggcttcgtggccatggtaaacaaagccatgagt
gccaagttcgagcggctggtcgcgagtgctgagcagctgctgaaggagctgccctggcct
cttgccttcgagaaggacaagttcctcacccctgacttcacctccctggacgtcctcacc
tttgctggctctggcattcctgcgggcatcaacatccccaactacgatgacctgagacag
acagaaggctttaagaatgtatcgctggggaatgtgctggctgtggcctatgccgcaaag
cgggagaagctcacgttcttggaggaggaagacaaggacctgtatatccgctggaagggg
ccgtcctttgatgtgcaggtggggttacacgagctgttgggccatggcagcggcaagctc
tttgtacaggatgagaaaggtgctttcaactttgacaaggagactgtgatcaacccagag
actggggaacagatccagagctggtaccggagtggagagacgtgggatagcaaattcagc
accattgcctccagctacgaagagtgccgggccgagagtgtgggcctctacctctgtctc
aacccccaagtgctggagatctttggctttgagggagctgatgcagaagatgtaatctac
gtgaactggctcaacatggttcgggctggcttgttggctttggagttctacaccccagag
gcagccaactggcgacaggcccacatgcaggcccggtttgtgatcctgcgggttttgctg
gaagctggcgaaggactcgttaccgtcactcccaccacaggctctgatgggcgccctgat
gcccgggtccgcctggaccgcagcaagatccggtcagtgggcagacctgccttggagcgg
ttcctgcggagactccaggtgctgaagtccacgggggacgtggtcgcggggcgggccctg
tacgagggctatgcagcagtcactgacgcacctccagagtgcttccttaccctaagggat
acggtactgctgcgcaaggagtcccggaagcttattgttcaacccaacactcgccttgaa
ggctcagaagtacaacttgtggagtatgaggcctcagccgctggtctcatccgctccttc
tgtgagcggtttcccgaggatgggcccgagttggaggaggttcttatccagctggctgca
gcagatgcccgattctggaggaaccaggcccaggaggccccacctggccaggcttga

DBGET integrated database retrieval system