KEGG   Mus musculus (mouse): 75234
Entry
75234             CDS       T01002                                 

Gene name
Rnf19b, 4930534K13Rik, 4930555L03Rik, Ibrd, Ibrdc3
Definition
(RefSeq) ring finger protein 19B
  KO
K11973  E3 ubiquitin-protein ligase RNF19B [EC:2.3.2.31]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    75234 (Rnf19b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     75234 (Rnf19b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    75234 (Rnf19b)
SSDB
Motif
Pfam: IBR zf-RING_5 zf-C3HC4 zf-RING_2
Other DBs
NCBI-GeneID: 75234
NCBI-ProteinID: NP_001355692
MGI: 1922484
Ensembl: ENSMUSG00000028793
Position
4; 4 D2.2
AA seq 732 aa
MGSEKDSESPRSTSLHAAAPDPKCRSGGRRRRLTFHSVFSASARGRRARTKPQAEPPPPA
APPPPPPPAPAPVEAQAPPVEALPSEPAAEAEAEAVAAGPEEDEAAEGGGAEEVECPLCL
VRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPISCPECSERLNPHDIRLLLADPP
LMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQ
IWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDGSCN
HMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISL
IAGIAIPAMVIGIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGI
GVPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWRALKNPSIGE
SSIEGLTSVLSTSGSPTDGLSVMQGPYSETASFAALSGGTLSGGILSSGKGKYSRLEVQA
DVQKEIFPKDTASLGAISDSASTRAMAGSIISSYNPQDRECNNMEIQVDIEAKPSHYQLV
SGSSTEDSLHVHAQVAEKEEEGNGAGGGSGGSEDDPPYKHQSCEQKDCLASKAWDISLAQ
PESIRSDLESSDTQSDDVPDITSDECGSPRSHAAACPSTPQVHGAPSPSAHKNLAAPAEG
QTVLKSEEYEVE
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgggctccgagaaggactccgagtcgccgcgctccacctcgctccatgcggccgccccc
gaccctaagtgccgcagcggcggccggcgccggcgcctcaccttccacagcgtcttctcc
gcctcggcccgcggccgccgcgcccggaccaagcctcaggccgaaccgccgcccccggct
gcgccgccgccgccgccgccgcccgctccggccccggttgaggctcaggccccgccggtg
gaagctctgccctccgagcccgctgccgaggctgaggcggaggccgtggctgccgggccg
gaggaggacgaggcggcggagggcggcggcgcggaggaggtggagtgcccgctgtgcctg
gtgcgcctgccgcccgagcgggccccgcgcctcctcagctgcccgcatcgctcgtgccgg
gactgcctccgccactacctgcgcctggagatcagcgagagccgcgtgcccatcagctgc
cccgagtgcagcgagcggctcaacccacacgacatccgtctgctgctggccgacccgccg
ctcatgcacaagtacgaagagttcatgctgcgccggtacctggcctcggaccccgactgc
cgctggtgtccggcccctgactgcggttatgctgttattgcctatggctgtgccagttgc
ccaaagctaacctgtgagagggagggctgccagactgagttctgctaccactgcaagcag
atatggcatccaaaccagacctgcgatatggcccgtcagcagagggctcagactttacga
gttcggaccaagcacacttcaggtctcagttacgggcaagaatctggaccagcagatgac
atcaagccatgcccacgatgcagtgcttacattatcaagatgaatgatgggagctgtaac
cacatgacctgtgcagtgtgtggctgtgaattctgctggctttgcatgaaagagatctct
gacttgcattacctcagtccctctggctgtacattctggggcaagaagccatggagccgc
aaaaagaaaattctttggcagttgggcacattgatcggtgctccggtggggatctcactc
attgctggcattgcaattcccgccatggtcatcggcatccctgtatacgtggggagaaag
attcacagcaggtacgagggaaggaaaacctccaagcacaagaggaatttggctatcaca
ggaggagtgaccttgtcagtcattgcatccccagtaatcgctgctgttagcgttggtatt
ggtgtccccattatgctggcatatgtttatggggttgtgcccatttctctttgccgtgga
ggtggctgtggagttagcacagccaatggaaagggggtaaaaattgagtttgatgaagat
gatggtccaatcacagtggcagatgcctggcgagccctcaagaaccccagcatcggagaa
agcagcattgagggcctgactagtgtgctgagtaccagcggaagccctacagatggactc
agtgtcatgcagggaccatacagcgagacagccagcttcgctgccctctcagggggcaca
ctgagtggtggtattctctccagcggcaagggaaagtacagccggttagaagttcaagct
gatgtccaaaaggaaattttccccaaagacacagccagtcttggtgcaattagcgacagc
gcaagcactcgtgctatggccggttccataatcagttcctacaacccacaggacagagag
tgcaacaatatggaaatccaagtggacattgaagccaaaccaagtcactatcagttggtg
agtggcagcagcacagaggactcgctccatgtccatgctcaggtggcagagaaggaagaa
gagggtaatggtgctggtggtggcagcggtggcagtgaagacgatcccccttacaaacac
caaagctgtgaacagaaagactgcctggccagcaaggcttgggacatcagcctggcccag
cctgagagcatccgcagtgacctggagagctctgacacgcagtcagatgacgtgccagac
atcacctcagatgagtgtggctcgccccgctcccatgctgcagcctgcccctccaccccc
caagtccacggtgcaccgagcccaagtgcccacaagaacctcgctgctccagctgagggc
cagactgtcttgaagtcagaagagtatgaagtggaatga

DBGET integrated database retrieval system