KEGG   Mus musculus (mouse): 75305
Entry
75305             CDS       T01002                                 

Gene name
Ankrd53, 4930564N15Rik
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    75305 (Ankrd53)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    75305 (Ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 Pox_A3L
Other DBs
NCBI-GeneID: 75305
NCBI-ProteinID: NP_083521
MGI: 1922555
Ensembl: ENSMUSG00000014747
Vega: OTTMUSG00000058016
UniProt: Q3V0J4 Q9CUG5
Position
6 C3; 6
AA seq 497 aa
MRRPSRRRSKASTPPRSHTTPRRTGPSDSRRRPGTKEQPRPSVQGGTRQAEHDLKVSSPN
SESSQYSTSELWSHKVIANYSELFAASVGNVDWLRFCVNPERKEIIVDDKGFTAIHFAAQ
KCQLSCLKVLIEEYKYPVDLPTNKGQTPLHLVIHKNNKSDILPCIDYLLKKGAAINSQTY
NGSTPLHLASCNGLLGCIKLLVQSGANVHARDATGFKPIDYCRLWNHRTCARFLKDVMWK
HDKKVLAQEMEKLRTLKEKLTILEYHYLVEYQKEHQILREAHFRKWLQNKVLAQTLGSAD
SKQKAGVQPWSLASNTLRCPITESLHYPSVEAQLKNLPSPVVPPKPIYKQTTISRPKLWN
YSANPARSPITNIGHPQNIRLGVHPEPYKEHDFRRFLEVTRNKHGGACLRTVDRQLVTPV
PQLPFEMMVRVLYPGTQPYRMKVPQGLYPRDILKVPEKRHVGDTCSNTMAMTLRETFDKP
FLDSLEVCRTRVAPPSK
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgcgacgcccctcgcggcgtcgttccaaagccagtacaccccctaggagccacaccact
ccgcgcaggactgggccctcggattccagaaggcgcccagggacaaaagagcagccccgc
ccatctgtacaaggaggcacgcggcaagcggaacatgacttgaaggtttccagccccaac
tccgaatcctcgcagtacagtacctccgagttgtggagccataaagtgatcgcgaactac
tccgagcttttcgcagcctcagtgggcaatgtggactggcttcggttctgtgtgaatccg
gagcgcaaggagatcatagtcgacgacaagggcttcacagccatccacttcgcagcccag
aaatgccagctttcctgccttaaggtcttaatagaggagtacaaatatcccgtggatctg
cccaccaacaaaggccagacgcccctgcacttggtcatccataaaaacaacaaatcggac
atcctcccctgcattgactacctgctcaagaaaggggcagccatcaactcgcagacatac
aatggctccacacccctgcacctggcttcctgcaatggcctgctgggatgcattaagctg
ctggtgcagagtggagccaatgtgcatgcccgagatgccacgggcttcaagcccatcgac
tattgcagactttggaaccaccgtacctgtgcccggttcttgaaggatgtcatgtggaaa
catgataagaaggtccttgcccaggagatggagaaactgaggaccttgaaggagaagctg
accattttggagtatcactacctggttgaatatcaaaaagaacatcaaattctgagagag
gctcatttcagaaagtggctccaaaacaaggtgctggcccagaccctgggttctgccgac
tccaagcaaaaggctggtgtccaaccttggtcattggcctccaacactttaagatgccca
ataactgaaagcctccattatccatctgtggaagctcagctgaaaaacttgccctcacct
gtggtgccacccaagcccatctacaagcagaccaccatcagtcggcccaagttatggaac
tatagtgctaaccctgccaggtcccccatcacaaacattggccacccacagaatattcgc
ctgggtgtgcacccagaaccctataaggaacatgacttccgcagattcctggaggtgact
cgaaataaacatgggggtgcatgcctgcgcacagtggaccgtcagttggtgacacctgta
ccccagctgccttttgagatgatggtccgagtgctgtacccagggactcaaccctacagg
atgaaagtgccccagggcttgtatccacgggacatactcaaagtacctgagaaacggcat
gtaggagatacttgtagcaatacaatggccatgaccctacgtgagacatttgataaaccc
ttcctcgattccctggaagtttgccggactcgagtagccccaccctccaagtga

DBGET integrated database retrieval system