KEGG   Mus musculus (house mouse): 75328
Entry
75328             CDS       T01002                                 
Symbol
Fam243, 4930563D23Rik
Name
(RefSeq) family with sequence similarity 243
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF5346 UQCC2_CBP6 DDE_3
Other DBs
NCBI-GeneID: 75328
NCBI-ProteinID: NP_083528
MGI: 1922578
Ensembl: ENSMUSG00000051728
Position
16:complement(92115651..92118329)
AA seq 251 aa
MARFTNCLLKNIFTRSQFDSAKRRQCLQYLNALRSLQHNGYKTVYFGETEIPETLVTGED
FSDSYYIHTPSWCILHAGGSQGWVPWKYRMFLRNDLCIKKEDSLFLEFCDVVKRAYGKCA
IVVKGRRQQDEMKPKTDKEGEAKAYVPTSINLTSIACSPGVAKSYGHELISLPPYYNYLN
PLDSAWSSMKWFIINNRKEFCLQSVDNVYTYRYILFSDLISKGIEKVNLTKWKAITNKVR
RWENYYLAKFS
NT seq 756 nt   +upstreamnt  +downstreamnt
atggctcgcttcacaaactgtcttctgaaaaacatctttaccagaagtcagtttgacagc
gccaagaggagacagtgccttcagtatctcaacgctctgagatcgctgcaacacaatgga
tacaagaccgtgtattttggggaaactgagatcccagaaactcttgtcactggggaggac
tttagtgacagctattacattcacacaccatcgtggtgtatcctacacgctgggggcagt
caaggatgggtgccttggaaatatcgcatgttcctgagaaatgacctgtgcatcaagaag
gaagacagcctgttcttggagttctgtgatgttgtgaagagggcctatggcaagtgtgcc
atcgtggtcaaagggagaaggcagcaagatgagatgaagccaaagacagacaaggagggg
gaggccaaggcctatgtcccaacaagcattaatttaacaagcattgcgtgttccccggga
gtggccaagtcctacggccatgaactcatctctctgcctccctactataattatctgaac
cccttagactcagcctggtcttccatgaaatggtttatcataaacaaccggaaggagttt
tgtctgcagtctgttgacaatgtctacacttatcgatacatactcttcagtgacttaata
agcaaagggattgaaaaggttaacctgaccaagtggaaggccataaccaacaaggtgcgc
aggtgggagaactattatcttgccaagttttcttaa

DBGET integrated database retrieval system