KEGG   Mus musculus (mouse): 75387
Entry
75387             CDS       T01002                                 

Gene name
Sirt4, 4930596O17Rik
Definition
(RefSeq) sirtuin 4
  KO
K11414  NAD+-dependent protein deacetylase sirtuin 4 [EC:2.3.1.286]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    75387 (Sirt4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    75387 (Sirt4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     75387 (Sirt4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     75387 (Sirt4)
SSDB
Motif
Pfam: SIR2
Other DBs
NCBI-GeneID: 75387
NCBI-ProteinID: NP_001161163
MGI: 1922637
Ensembl: ENSMUSG00000029524
Vega: OTTMUSG00000014665
UniProt: Q8R216
Position
5; 5 F
AA seq 333 aa
MSGLTFRPTKGRWITHLSRPRSCGPSGLFVPPSPPLDPEKIKELQRFISLSKKLLVMTGA
GISTESGIPDYRSEKVGLYARTDRRPIQHIDFVRSAPVRQRYWARNFVGWPQFSSHQPNP
AHWALSNWERLGKLHWLVTQNVDALHSKAGSQRLTELHGCMHRVLCLNCGEQTARRVLQE
RFQALNPSWSAEAQGVAPDGDVFLTEEQVRSFQVPCCDRCGGPLKPDVVFFGDTVNPDKV
DFVHRRVKEADSLLVVGSSLQVYSGYRFILTAREQKLPIAILNIGPTRSDDLACLKLDSR
CGELLPLIDPRRQHSDVQRLEMNFPLSSAAQDP
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagcggattgactttcaggccgacaaagggccgttggatcacccacctcagccggccg
cgttcttgtggaccctcggggttatttgtgccgcccagccctcctttggaccctgaaaag
atcaaagagttacagcgcttcattagcctttccaagaaactcctcgtgatgacaggcgcg
gggatctccaccgagtccggcatcccagactacaggtcagaaaaggtgggactttacgcc
cgcactgaccggagacccatccagcacattgatttcgtccgcagtgctccggtccgccag
cggtactgggcccgaaactttgtgggctggcctcaattctcctctcaccaacccaaccca
gcacactgggctctgagcaactgggagagactggggaagctgcactggttggtgactcag
aacgtggacgctttgcactccaaagcagggagtcagcggctgacggagctccacggatgc
atgcacagagtcctgtgcctgaactgtggggagcagactgcccgcagggtgctgcaggaa
cgcttccaagccctgaaccccagctggagcgccgaggcgcagggcgtggctcccgacggc
gacgtgttcctcactgaggagcaggtccggagctttcaggtcccgtgctgtgatcgatgc
ggcggccctctgaaaccggacgtcgttttctttggggacacggtgaacccagacaaggtt
gactttgtgcaccggcgtgtgaaagaggcggactccctactggtggtgggatcatccctg
caggtgtactctggttacaggttcatcctcaccgcccgcgagcaaaagctcccaatagcc
attctgaatatcggccccacccggtctgacgatttggcttgcctgaagctggattcccgc
tgtggagagttgctgcctttaatagacccgcggagacagcactctgatgtccaaaggctg
gaaatgaactttcctctgagttccgctgctcaagatccctaa

DBGET integrated database retrieval system