KEGG   Mus musculus (house mouse): 75398
Entry
75398             CDS       T01002                                 
Symbol
Mrpl32, 0610033O15Rik
Name
(RefSeq) mitochondrial ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    75398 (Mrpl32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    75398 (Mrpl32)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    75398 (Mrpl32)
  Bacteria
    75398 (Mrpl32)
SSDB
Motif
Pfam: Ribosomal_L32p zf-ribbon_3 DUF5347 DZR
Other DBs
NCBI-GeneID: 75398
NCBI-ProteinID: NP_083547
MGI: 2137226
Ensembl: ENSMUSG00000015672
UniProt: Q9DCI9
Position
13:complement(14784886..14787622)
AA seq 187 aa
MAPSLLLLSLPWPVRPGPLQRCWELLQRQLQQSWSRFVSPPWAPALAVQRPSILTELAHD
TCENKENSSFLDSIFWMAAPKNRRTIEVNRCRRRNPQKLIKIKNNIDICPECGHLKQKHV
LCGYCYEKVRQETTKIRQQIGAQEGGPFRAPSVETMVLYTGEKPSEKDQGKRIVERNIKR
PSWFTQN
NT seq 564 nt   +upstreamnt  +downstreamnt
atggctccttcgttgctgctgctttcactaccatggccggtgcgtcccggaccgctccag
aggtgctgggagctgctacaacggcaactgcagcagagctggagtcgctttgtcagtcct
ccgtgggcaccagcattagccgtccagagaccatccatcctcacagagctagcacatgat
acttgtgaaaataaagagaattccagctttttagatagtatcttttggatggcagctccc
aaaaacagacgcaccatcgaagttaaccgatgtaggagaagaaaccctcaaaagcttatt
aaaattaagaacaatatagacatttgccctgaatgtggtcacctgaagcagaaacatgtc
ctttgtggatattgctatgagaaagtacgccaggagacgacaaaaatcagacaacaaata
ggggctcaagaaggaggtcctttcagagctccttccgttgagactatggtgctgtacaca
ggagagaaaccatcagaaaaggatcagggcaagaggattgttgaaagaaacataaagagg
ccatcttggttcacccagaattga

DBGET integrated database retrieval system