KEGG   Mus musculus (mouse): 75404
Entry
75404             CDS       T01002                                 

Gene name
Arhgap36, 1100001E04Rik, rho-gap
Definition
(RefSeq) Rho GTPase activating protein 36
  KO
K20648  Rho GTPase-activating protein 36
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75404 (Arhgap36)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    75404 (Arhgap36)
SSDB
Motif
Pfam: RhoGAP
Other DBs
NCBI-GeneID: 75404
NCBI-ProteinID: NP_001074592
MGI: 1922654
Ensembl: ENSMUSG00000036198
Vega: OTTMUSG00000017740
UniProt: B1AUC7
Position
X; X A5
AA seq 590 aa
MAWMLDCLFASAFEPRPRRVSVLGGAPGQNSDRSMDMVSIHSLSELERLKLQETAYHELV
ARHFLSEFKPDRALPTDRPNTLEKWFLMLRGQDRAASLKTFGIRLEEVLVNELTRRKQRE
LTPTMQVEDINGSTGRRRRGNVVQRMLGRMRRFFSRRRNEPTLPREFTRRGRRGAVSADS
ADELENGALLLQILQLSQLSSPIGQRLLGSKRKMSLNPIAQQIPQIVETCCKFIEKHGLS
SVGIFTIEYSLRRVLELRELFDKGLDIVLDDSVNVHDVAELLKEFFREMKDPLLPDDLYM
SFLLTATLKPKDQVSALQLLVYLMPPCHSDTLERLLKALHKITENCEDSIGVDGQLVPGN
RMTSTNLALVFGTALLKKGKLANKESRKTKLGIDHYVASVNVVRAMIDNWDILFQVPPHI
QKEVAKRVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVENSAEAQAAILAQSQP
FDEDPEGAPDVHEVLNDNLNYDFEDESDFEDQDHLDLAEVPYLDVIPNNEDTDSDADVIP
GPSEEPAVPASTAGSPDKEEGAAGNPPNADRPLPRVPQGKKGKFATRFFP
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggcgtggatgctggactgcctattcgcatcggcctttgagccccgcccccgccgtgtg
agcgtcctgggaggagccccaggacagaactcagaccgcagcatggacatggtatccatt
cacagcctctctgagctggagcgcctgaagctgcaagagactgcttaccacgaactcgtg
gccagacatttcctctctgaattcaagccggacagagctctacccactgaccgtccaaac
accctggagaagtggtttttgatgctgagaggacaagacagggctgcatcactcaagacc
tttggcatccgcctggaagaggtactggtgaacgagcttacccgtcgcaagcagcgtgaa
ctgacacccacgatgcaggttgaagatatcaacggttctactggtcgtcgtcgtcgggga
aacgtggtgcaaagaatgcttggacgcatgaggcgctttttcagtcgcaggaggaatgag
cccaccctgcctagagagttcactcgccgtggacgtcgaggtgcagtttctgcagatagc
gcagatgaactggagaacggagccctgctgctgcagatcctgcagctctcccagctttca
tcgcctattggacagcggcttctgggatccaagaggaagatgagcctcaacccaattgct
caacaaatccctcagattgttgagacttgttgcaaattcattgagaaacatggcttaagc
tcagtggggattttcaccattgaatactctctgcggagggtgcttgagctccgtgagtta
tttgacaaaggcctggatattgtactggatgacagtgtgaatgtccatgatgtggctgag
ctcctcaaggagttttttcgtgagatgaaggaccctctgctgcctgatgatctgtacatg
tccttcctcctgactgcaactctgaagcccaaggatcaggtttctgccctgcagcttctg
gtttatctgatgccaccttgccacagtgatactctcgaacgtctgctgaaggctctgcat
aaaatcactgagaactgtgaagactccattggcgttgatggacagctggttccaggtaac
cgaatgacttccaccaacttggctttggtgtttggaactgctctcctgaagaaggggaag
ttggccaacaaggaatccaggaagactaaactggggattgatcactatgttgcatctgtc
aatgttgtccgtgccatgattgataactgggacatcctcttccaggtgcccccccatatt
cagaaggaggttgctaagcgtgtgtggaagtccagccctgaagccctggattttatcaga
cgccggaatctgaggaagatccagagtgctcgcataaagatggaagaggatgctttactt
tctgatccagtggaaaactctgctgaagcccaggctgctatccttgctcagagccagccc
tttgatgaagaccccgaaggagccccagatgtgcacgaggtcttgaatgataacctgaac
tatgactttgaagacgaatcggattttgaagaccaggaccatctggatcttgcagaggtt
ccctatcttgatgtaattccaaacaacgaagataccgactcagacgctgatgtaatccca
ggtccctctgaggagcctgctgtgcctgccagcactgctggttcccctgacaaagaggaa
ggagcagccggtaacccccccaacgcagaccgcccactgccccgtgtgccccaggggaag
aagggcaaatttgccacccgcttctttccttag

DBGET integrated database retrieval system