KEGG   Mus musculus (mouse): 75415
Entry
75415             CDS       T01002                                 

Gene name
Arhgap12, 2810011M08Rik
Definition
(RefSeq) Rho GTPase activating protein 12
  KO
K20636  Rho GTPase-activating protein 12/27
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75415 (Arhgap12)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    75415 (Arhgap12)
SSDB
Motif
Pfam: SH3-WW_linker RhoGAP PH SH3_9 WW PH_9 SH3_1 DUF2255 Glyco_hyd_101C SH3_10
Other DBs
NCBI-GeneID: 75415
NCBI-ProteinID: NP_001034781
MGI: 1922665
Ensembl: ENSMUSG00000041225
Vega: OTTMUSG00000036618
UniProt: Q8C0D4
Structure
PDB: 
6GVC

Position
18; 18 A1
AA seq 838 aa
MAERSGKITAGQAYIEVEYDYEYDAKDRKIVIRQGERYLLVKKTNDDWWQVRPDENSKAF
YVPAQYVKEVTRKALMPPVKQATGLPNNSMKTIQSMHLQRSTENVNKMPELSSFGKPSSS
VQGTGLIRDANQNFGSNYNSGQTLNLSLDLTHNNGKFNSDSHSPKVSSQNRTRLFGHFPG
PEFLDIEKTSFSQEQSCDSAGEGSERIQQDSESGDELSSSSTEQMRATTPPNQGRPDSPV
YANLQELKISQSALPPLPGSPAIQVNGEWETHKDSSGRCYYYNRTTQERTWKPPRWARDV
STSRDFQSPGEQEPLSSEENYHSSCFSQSDSQCGSPPRGWSEELDERGHTLYTSDYTKEK
WLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHS
TIVLDSNDKDSPTTTKLCLPENESPPTSSKHQDPGQEKYGLLNVTKITENGKKVRKNWLS
SWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGAVIEMASKDKSSKKNVFELKTR
QGTELLIQSDNDAVINDWFKVLSSTINNQVAEADEAAEEETPDSPGVEKHDKEKDQKELK
KLRSMKGSSMDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGSNLANLCQRENGT
VPKFVKLCIEHVEEHGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWEDIHVITG
ALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVTAVKDLIRQLPKPNQDTMQILFRHLK
RVIENGEKNRMTYQSIAIVFGPTLLKPERETGNIAVHTVYQNQIVELILLELSTVFGR
NT seq 2517 nt   +upstreamnt  +downstreamnt
atggccgagagaagtggaaagatcactgcaggacaagcgtatattgaggtggagtatgat
tatgagtatgacgcaaaggacagaaagattgtgatcagacaaggggagcgctacctcctg
gtgaagaagaccaatgatgactggtggcaagtcagacctgatgagaactcaaaagcattt
tatgtgccagcacagtatgtcaaggaggtcactcgcaaagctctgatgccacctgtgaag
caggcaacaggactgccaaataactctatgaagacaatacagagtatgcatctccagaga
tcgacagaaaatgtgaacaaaatgcctgagctttcaagttttggaaagccatcgtcatct
gttcaaggaacaggtcttattcgtgatgccaatcagaatttcggatccaattataattca
ggccagactctcaacctaagcctggacctgacccataataatggaaagtttaacagtgac
tcacattctcctaaagtttccagccagaataggacacgcttatttggtcattttcccggg
ccagagttcttggacatagagaaaactagcttctctcaggaacagtcatgtgactcagct
ggagaaggctccgaaagaatacagcaggattccgagtctggagatgaacttagcagcagc
tccactgagcagatgagggcaaccacaccccctaatcaaggaaggccagattctccagtc
tatgctaacctacaggaactgaaaatatcacagtctgctcttcctcctcttcctgggagc
ccagcaattcaagttaatggggaatgggagactcacaaagacagttcaggccgttgttac
tactataaccgcacaacccaggagcgaacctggaaaccacctcgatgggctcgagatgtg
agcacaagccgagattttcagagcccaggagagcaagagcctctttcatcagaagaaaac
taccacagcagttgtttcagccagtcagatagtcagtgtggctctcctcccaggggttgg
tcagaagagctggatgaacgtgggcataccttgtataccagtgactatactaaggaaaag
tggctcaagcatgttgatgatcaaggtagacagtattactacagcgcagatggatctcgg
tcagagtgggaattgccaaagtataatgcttcatctcagcagcaaagagaaataattaaa
agtaggagcttggacaggcggctgcaagaaccaatagtgttaactaaatggagacatagc
accattgtgttggactccaacgacaaggattctccaactaccacaaaactctgcttacct
gaaaatgaatctcctcctacttcatcaaagcatcaagatccaggtcaggagaaatatgga
ctgttaaatgtaacaaaaattactgaaaatgggaaaaaagttcgaaagaactggttgtct
tcttgggcagtgctgcagggttcgtctttactttttacgaaaactcaaggaagtagtaca
agctggtttgggagtaatcagtccaaaccagaattcacagtggacctgaagggggcagtg
attgaaatggcatcaaaggacaaatcgagcaagaagaatgtatttgagctgaaaactcga
caaggaacagaactgctaattcagtctgataatgatgctgttattaatgattggtttaaa
gttcttagtagtactatcaataaccaggtagcagaggccgatgaagcagctgaagaggaa
acaccagattcaccaggggtagaaaagcatgataaagaaaaggaccagaaggagcttaaa
aaacttcgctcaatgaaaggatccagcatggattcttcagagcagaagaaaactaagaaa
aacttaaagaagtttcttacccggcgccccactttgcaagctgttcgtgagaaaggttat
atcaaagatcaagtatttggatctaatcttgctaatctgtgtcagagggagaatgggaca
gtgccaaagtttgtgaagttatgcattgagcatgtcgaagagcatggtttagatgttgat
ggtatttacagagtgagtggcaaccttgccgtgatccagaagctgaggttcgcagtcaat
catgatgagaagttggacttgaatgacagtaaatgggaagacattcatgtcatcacggga
gcactcaaaatgttttttcgagaactaccagaacctctttttacgtttaatcatttcaat
gattttgttaatgcaattaaacaagaaccgagacagcgtgtcactgcagttaaggaccta
atcagacagttgccaaagccaaatcaagatacaatgcagattctgtttagacatctcaaa
agggttatagaaaatggagaaaaaaaccgaatgacctatcagagcatagcgattgttttt
ggccccacccttctaaagccagaaagagagactggtaatatagcagttcatactgtgtac
cagaaccagattgtagagctgattctcctggaattaagcactgtctttggacgttga

DBGET integrated database retrieval system