KEGG   Mus musculus (mouse): 75424
Entry
75424             CDS       T01002                                 

Gene name
Zfp820, 2610036F08Rik
Definition
(RefSeq) zinc finger protein 820
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_11 KRAB zf-C2H2_6 zf-H2C2_5 zf-met C1_1 C1_4
Other DBs
NCBI-GeneID: 75424
NCBI-ProteinID: NP_083557
MGI: 1922674
Ensembl: ENSMUSG00000069743
UniProt: E9Q5G8 Q9CSX8
Position
17; 17 A3.3
AA seq 549 aa
MNASLLNVPQGQLTFKDVAVDFSQEEWECLDCAQRALYMDVMLENYNNLFFVETHGMCPK
YKNILDQDLQHIVHEHVNIQVKSYKCHELGKIIHESTQSTPYKTNLRATSVESSNLSRHE
TENNREPCKSKSPVNCLNLFSTISLTQGIHRRKKEYYGTELVKVFDSKQKLKLKQTNNRE
KPYKCSECDKCFTKKCKLRQHQRIHTGEKPYKCSECDKCFTQKDRLIIHQRVHTGEKPYK
CSECDKGFTSKSRLNIHQRVHTGEKSYKCSECDKSFSQQGNLSIHLRIHTGEKPYKCSEC
DKCFTYKSGLRSHQIIHTGEKAYKCSECGKCFTHKGDLRRHQSIHMGEKPYKCSECDKGF
TQKCRLIIHQIIHTGKKGYKCSECDKCFILKSDLSIHQRIHTGEKPYECSECGKGFTSKS
RLNIHQRVHTGEKSYKCSECDKSFTQQGNLRIHLRIHTGEKPYKCSECDKCFTYKSGLRS
HQIIHTGEKAYKCSECGKCFTHKGDLRRHQSVHMGEKPYKCSECDKGFTQKMPSYHSSDN
SYRKERLQM
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgaatgcttctctcctaaatgttcctcagggtcagttaacattcaaggatgtggcagtg
gacttctcacaggaggaatgggaatgtcttgattgtgctcagagggcactgtacatggat
gtgatgttggagaattacaataatctgttttttgtggagacccatgggatgtgtcctaaa
tataagaacatcttggatcaagaccttcagcatattgtccatgagcatgtgaatatccaa
gtgaaatcttataaatgtcatgagcttggcaaaatcattcatgaatccacccaaagtaca
ccttataaaactaacctcagggctacatctgttgaatcatcaaacctaagcagacatgaa
actgaaaacaacagagaaccttgcaaatctaaaagccctgttaactgtttaaatttgttc
tctaccattagtttaactcagggaatccacagaagaaaaaaagaatactatggtacagag
cttgttaaggtttttgactctaaacaaaaactcaagctgaagcaaaccaataatagagaa
aaaccttacaaatgtagtgaatgtgacaaatgtttcaccaagaaatgcaagcttagacaa
catcagagaattcatacaggagagaaaccttacaaatgtagtgaatgtgacaaatgcttt
acccaaaaagacagacttattattcatcagagagttcatacaggagagaaaccttacaaa
tgtagtgaatgtgacaaaggctttaccagcaaaagccgtcttaatattcatcagagagtt
catacaggagagaaatcatacaaatgcagtgaatgtgacaaatctttttctcagcaaggc
aatcttagtattcatctgcgaattcatacaggagaaaaaccttacaaatgtagtgaatgt
gacaaatgctttacctacaaaagtggccttagaagtcatcagattatccacacaggagag
aaagcttacaaatgtagtgaatgtggcaaatgctttacccacaaaggtgatcttagaaga
catcagagcattcatatgggagaaaaaccttacaaatgtagtgaatgtgacaaaggcttt
actcaaaaatgccgtcttatcattcatcagataattcatacaggaaagaaaggttacaaa
tgtagtgaatgtgacaaatgctttattctcaaaagtgatcttagtattcatcagagaatt
catacaggagagaaaccttacgaatgtagtgaatgtggcaaaggctttaccagcaaaagc
cgtcttaatattcatcagagagttcatacaggagagaaatcatacaaatgcagtgaatgt
gacaaatcttttactcagcaaggcaatcttagaattcatctgcgaattcatacaggagaa
aaaccttacaaatgtagtgaatgtgacaaatgctttacctacaaaagtggccttagaagt
catcagattatccacacaggagagaaagcttacaaatgtagtgaatgtggcaaatgcttt
acccacaaaggtgatcttagaagacatcagagcgttcatatgggagaaaaaccttacaaa
tgtagtgaatgtgacaaaggctttactcaaaaaatgccgtcttatcattcatcagataat
tcatacaggaaagaaaggttacaaatgtag

DBGET integrated database retrieval system