KEGG   Mus musculus (house mouse): 75452
Entry
75452             CDS       T01002                                 
Symbol
Ascc2, 1700011I11Rik, 2610034L15Rik, AI482016, ASC1p100, AW046480
Name
(RefSeq) activating signal cointegrator 1 complex subunit 2
  KO
K18667  activating signal cointegrator complex subunit 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    75452 (Ascc2)
SSDB
Motif
Pfam: CUE
Other DBs
NCBI-GeneID: 75452
NCBI-ProteinID: NP_083567
MGI: 1922702
Ensembl: ENSMUSG00000020412
UniProt: Q91WR3
Position
11:4587698..4635699
AA seq 749 aa
MPALPLDQLQITHKDPKTGQPKTSAALNPEQKADRYFVLYKPPPKDNIPALVEEYLERAN
FVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLHYVPRKFDEWVAPTPEVADMQNHLH
RSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMI
GNIFTQQPSYYTDLDETIPTILQVFSNILQHCGLQGDGTSTTPQKLGERSPLTPSDMPLL
ELKDIVLYLCDTSTTLWAFLDIFPLACQTFQKHDFCYRLASFYEMAIPELESAIKKRRLE
DSKLLGDMWQRLSHSKKKLMEVFHIILNQICLLPILESSCDNIQGFIEEFLQIFSSLLQE
KRFLRDYDTFSPVAEDISLLQQASSALDETRTAYILQAVESAWEGVDRQKIKDIKDPPRA
KGSNNEVTVTAEPVSEMPSQLENLEEDEECMGAAAALGPAVSGVELDSLISQVKDLLPDL
GEGFILACLEHYSYDSEQVINNILEDRLAPELSQLDRGLERQVKPDPTPLLSSRHNIFQN
DEFDVFSRDSVDLSRVHKGRRKEENVRSLVNDKQAVVAQWQRYQKYSVVVEEVPLQPGEY
QADDYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKMPGEVQEEEWDEEDEV
EEEAPKPDHFIQDPAVLREKAEARRMAFLARKGYRPENSTAVTGGPRGHGQSRETTQERR
KKEANKAARANHNRRTMADRKRSKGMIPS
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgccagctctgcccctggaccaactccagatcacccacaaagacccgaagacaggacag
ccgaagacttcagcagcgctgaaccctgagcagaaggcagaccggtattttgtgttgtac
aaaccgccccctaaagacaacattcccgccctagtggaggagtacctggaacgtgccaac
ttcgtagctaatgacctcgactggctcctggccttgcctcacgataaattctggtgccag
gttatttttgatgagaccctgcagaagtgcctggactcctacctgcactatgtaccccga
aagtttgatgagtgggtggccccgacccctgaggtggctgacatgcagaatcacctgcac
cggagtgttttcctcaccttcctccgaatgtccacgcacaaggaatccaaagaccacttc
atttctccatctgcatttggagaaatcctctacaacaacttcctctttgacatcccgaag
atcctggacctctgtgtgctctttggaaaaggcaactcaccactgctccagaaaatgata
ggaaacatatttacccagcagccaagttactatactgacctggatgaaaccattcccacc
atacttcaggtcttcagcaatatcctccagcactgtggtttgcaaggggatgggaccagc
accacaccccagaaactcggggagaggagtccgttgacccccagtgacatgcctctcttg
gaattaaaggacattgttctctacctgtgtgacacctccaccacactctgggcctttctg
gacatctttcctttggcctgccaaaccttccagaaacatgacttttgttacagactagct
tccttttatgagatggcaattccggaattggagtctgcaattaagaagaggaggcttgaa
gacagcaagctcctgggtgacatgtggcagaggctctcccattccaagaagaagctaatg
gaggtgtttcacatcatcctgaaccagatctgcctgcttcccattctagagagcagctgt
gacaacattcaaggcttcattgaagaattccttcaaatcttcagctctttactgcaggaa
aaaagattcctccgtgactacgacacattctcccctgtagctgaagatatcagcttgctg
cagcaagcttcatcagccttggatgagacccggactgcctacatcctccaggctgtggaa
agtgcctgggaaggggttgacagacagaaaatcaaggacattaaagacccaccaagggcc
aagggttctaataatgaagtcacagtgacagcagagccggtcagtgagatgccatcccag
ctggagaacttagaagaggatgaggagtgcatgggtgcagcagctgcgctgggccctgcc
gtgagtggtgtggaactagactcactcatctcccaagtgaaggacctgctgccagacctc
ggcgagggctttattctggcctgcctggagcactacagctatgactcagagcaggtgatc
aacaacatcctggaggatcggctggcccctgagctcagtcagctggaccgaggcctagaa
agacaagtgaagccggaccctacacccctgttgtcatctcgtcacaacatcttccagaac
gatgagtttgatgtgttcagcagggactcggtggacctgagccgagtgcacaagggcagg
aggaaggaggagaacgtgaggagcctggtgaatgacaagcaggctgtggtggcacagtgg
cagcgctaccagaagtacagcgtggtggtagaggaggtccccctgcagccaggagaatac
caggctgatgactatgaggacgagtatgacgacacatacgatggcaaccaggtgggcgcc
aacgatgcagactctgatgacgagctcatcagccgcaggcccttcaccatccctcaggtg
ctgagaaccaaaatgcctggcgaagtgcaggaggaggagtgggatgaagaggatgaggtg
gaagaggaggcccccaagccagaccatttcatccaggatcctgcagtgctgagggaaaag
gctgaagccaggcgcatggccttcctcgccaggaaggggtatcggcctgagaactccacg
gcagtaacaggcggcccccggggccatgggcaaagccgggaaacaacccaggaacgcagg
aagaaagaagccaacaaggcagccagagccaaccacaaccgtagaaccatggctgaccga
aaaagaagcaaaggcatgattccatcctga

DBGET integrated database retrieval system