KEGG   Mus musculus (house mouse): 75459
Entry
75459             CDS       T01002                                 
Symbol
Syce3, 1700007E06Rik, TSEG-2, TSEG2
Name
(RefSeq) synaptonemal complex central element protein 3
  KO
K19536  synaptonemal complex central element protein 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    75459 (Syce3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Meiosis-specific sister chromatid cohesion proteins
   Synaptonemal complex
    75459 (Syce3)
SSDB
Motif
Pfam: Synaptonemal_3 FlgN Acetate_kinase DUF2935 Pox_polyA_pol_C FapA
Other DBs
NCBI-GeneID: 75459
NCBI-ProteinID: NP_001156352
MGI: 1922709
Ensembl: ENSMUSG00000078938
UniProt: B5KM66 E7D6R1
Structure
Position
15:complement(89274377..89294706)
AA seq 88 aa
MADSDPGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMR
RLEDAFLNCKEEMEKNWQELLTETKRKQ
NT seq 267 nt   +upstreamnt  +downstreamnt
atggctgattccgatcctggggaaagaagctatgataacatgctgaaaatgctgtctgac
ctgaacaaggacctggaaaagctattggaagagatggaaaaaatctcagtgcaggcaacc
tggatggcctatgatatggtggtcatgcgtacgaaccccacactagcagagtccatgcgc
cggctagaagacgccttcctcaactgcaaagaggagatggagaagaactggcaagagctg
ctcactgagaccaagcgcaagcagtga

DBGET integrated database retrieval system