KEGG   Mus musculus (house mouse): 75465
Entry
75465             CDS       T01002                                 
Symbol
Dynlrb2, 1700009A04Rik, DNLC2B, Dncl2b
Name
(RefSeq) dynein light chain roadblock-type 2
  KO
K10419  dynein light chain roadblock-type
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    75465 (Dynlrb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75465 (Dynlrb2)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    75465 (Dynlrb2)
   04812 Cytoskeleton proteins [BR:mmu04812]
    75465 (Dynlrb2)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    75465 (Dynlrb2)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Dynein arm
   75465 (Dynlrb2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     75465 (Dynlrb2)
SSDB
Motif
Pfam: Robl_LC7 LAMTOR5 UPF0176_N
Other DBs
NCBI-GeneID: 75465
NCBI-ProteinID: NP_083573
MGI: 1922715
Ensembl: ENSMUSG00000034467
UniProt: Q9DAJ5
Position
8:117231754..117242654
AA seq 96 aa
MTEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDI
DPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE
NT seq 291 nt   +upstreamnt  +downstreamnt
atgacagaagtggaggaaaccctcaagagaatccagagtcacaaaggggtcatcggaacg
atggtggtcaatgcagaaggcattccaatccgaacaaccctggacaactccacaacggtt
cagtatgcgggtcttctccaccagctgaccatgaaagccaagagcacagtcagggatatt
gacccccagaacgacctgacttttcttaggatcagatcgaagaaacatgaaatcatggta
gccccagataaggaatatcttctgattgtcattcagaacccatgtgagtag

DBGET integrated database retrieval system