KEGG   Mus musculus (mouse): 75472
Entry
75472             CDS       T01002                                 

Gene name
Cfap126, 1700009P17Rik, AV282292, Fl, Fla, Flattop, Fltp
Definition
(RefSeq) cilia and flagella associated protein 126
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: DUF4248
Other DBs
NCBI-GeneID: 75472
NCBI-ProteinID: NP_001074744
MGI: 1922722
Ensembl: ENSMUSG00000026649
Vega: OTTMUSG00000021658
UniProt: Q6P8X9
Position
1; 1 H3
AA seq 189 aa
MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKASP
WGSFMGTWQMPLKIPPAKVTLTARTTTAADNLTKWIHKNPDLLNACNGLRPEISGKPFDP
DSQTKQKKSVTKTVQQAPNPTIIPSSPVIQGDNPDEPQSSHPSAGHTPGPQTPVNSPNNP
PPSPCKSTK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccactaactacagtgccaaccagtatgaaaaagcttacttacccacgtacctgcag
aactggtctcctgccaggccaacgaaagagaaaatcgctgcccatgaaggttacactcag
atcatcgccaacgatcgagggcatctcttgccttcagtgccccgttccaaggcaagtcct
tggggttccttcatgggcacctggcaaatgcccctgaagatcccacctgctaaggtgacc
ttgaccgcccgtacaactacagctgccgacaacctcaccaaatggatacacaagaatcct
gatctactcaacgcctgtaatgggctgcgtcctgaaatctcaggcaagcccttcgatcct
gacagtcagacgaaacagaagaaatctgtcaccaagactgtacaacaagcaccaaatcca
accataattcccagctccccggttatccaaggagacaacccagatgaaccgcaaagctcg
cacccctctgcaggtcacactccaggtccccaaactccagtcaactctcccaacaaccca
cctccgagcccttgtaagagcaccaagtag

DBGET integrated database retrieval system