KEGG   Mus musculus (mouse): 75475Help
Entry
75475             CDS       T01002                                 

Gene name
Oplah, 1700010G02Rik, 5-OPase
Definition
(RefSeq) 5-oxoprolinase (ATP-hydrolysing)
  KO
K01469  5-oxoprolinase (ATP-hydrolysing) [EC:3.5.2.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    75475 (Oplah)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.9  5-oxoprolinase (ATP-hydrolysing)
     75475 (Oplah)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydantoinase_B Hydantoinase_A Hydant_A_N DUF896
Motif
Other DBs
NCBI-GeneID: 75475
NCBI-ProteinID: NP_694762
MGI: 1922725
Ensembl: ENSMUSG00000022562
Vega: OTTMUSG00000035743
UniProt: Q8K010
Position
15; 15 D3
AA seq 1288 aa AA seqDB search
MGSPEERFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQERG
VLLPRGRPLDTSHIASIRMGTTVATNALLERQGERVALLVTRGFRDLLHIGTQARPDLFD
LAVPMPEVLYEEVVEVDERVLLYRGEPGAGSPVKGCTGDLLEIQQPVDLAALRGKLEGLL
TRGIHSLAVVLMHSYTWAQHEQQVGTLARELGFTHVSLSSEVMPMVRIVPRGHTACADAY
LTPTIQRYVQGFRRGFQGQLKNVQVLFMRSDGGLAPMDAFSGSRAVLSGPAGGVVGYSTT
TYQLEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL
FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSP
EASRKALEAVAMEVNSFLASGPCPASQLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP
SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLSYT
PETFAQLDQRLSRLEEQCVDALQAQGFSRSQISTESFLHLRYQGTDCALMVSANQHPATT
CSPRAGDFGAAFVERYMREFGFIIPERSVVVDDVRVRGTGRSGLQLEETSKIQSGPPHVE
KVTQCYFEGGYQETPVYLLGELGYGHQLQGPCLIIDNNSTILVEPGCQAEVIETGDIRIS
VGAEAPSMIDTKLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG
GLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
PGQSRPVFYVASRGHHADIGGITPGSMPPHSTTLQQEGAVFLSFKLVQGGVFQEEAVTEA
LQAPGKISGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA
ELAVRDMLRAFGTSRQARGLPLEVSAKDHMDDGSPICLHVQINLNQGSAVFDFSGSGSEV
FGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVQVIIPKGSILDPSPEAAVVGGNV
LTSQRVVDVILGAFGACAASQGCMNNVTLGNARMGYYETVAGGAGAGPGWHGRSGVHSHM
TNTRITDPEILESRYPVILRRFELRPGSGGRGRFRGGDGVVRELVFREEALLSVLTERRA
FQPYGLHGGEPGTRGLNLLIRKDGRTVNLGGKTSVTVYPGDAFCLHTPGGGGYGDPEDPA
PPPGSPPLYPAFPERGSVYEYRRAQEAV
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcccagaagagcgcttccattttgccatcgaccgtggtggcacctttacagat
gtctttgcccagtgcccaggagggcatgtacgtgtcctgaagctgctctcagaggatcct
gccaactatgcagacgcacccacagagggcatccgccgaattctagagcaggagaggggt
gtgctgctgccccgaggccggccgctagacaccagtcacatcgccagcatccgcatgggt
accaccgtggccaccaatgctctgttggaacggcagggagaacgggtggcactgctggtg
actcgcggtttccgagacctgctgcatattggcactcaggcccgcccagacctctttgac
ctggctgtgcccatgccagaggtactgtatgaggaggtcgtggaggtggacgagcgagtg
ctgctgtatcgtggagaacccggtgccggctctcccgtcaaaggctgtacaggggacctg
ctagagatacagcagcctgtggatctggcagccctgcgtgggaagctggaggggctcttg
actcggggcattcacagcctggcagtggtactcatgcattcgtacacgtgggcccagcac
gagcagcaggtgggcacactggcccgggagctgggcttcacgcacgtctccttgtcctcg
gaagtcatgcccatggtgcggattgttcctcgggggcatacggcctgtgcagatgcttac
ctcactcccaccatccagcgctatgtgcagggcttccgccgaggcttccagggccagcta
aagaatgtgcaagtcctcttcatgcgctccgatggtggcctggcacccatggatgccttc
agtggctcccgggctgtgctctctggccctgctggtggtgtggttggctactccactacc
acctaccagctggaaggtggtcagcctgtcattggctttgacatgggaggcacatccaca
gatgtgagccgctatgctggagagtttgagcacgtctttgaggctagcacggcaggtgtt
accctccaggccccacagctggacatcaatacggtggcagctggcgggggttcccgcctc
ttcttcaggtctggcctctttgtggttggtccagagtcagcaggtgcccacccaggtcct
gcctgctaccgcaaagggggtcctgtgacagtgacagatgctaatctggttctgggtcgc
ctgctgcctgcctccttcccctgcatttttgggccaggagaagaccagccattgtctccc
gaggcttcccgaaaggctctagaggctgtggccatggaggtcaacagtttcttggccagt
ggaccctgcccagcttcccagctaagtctggaggaggtggccatggggtttgtgcgtgtt
gccaacgaagccatgtgccggcctatccgtgccctcacacaggcacgaggccacgacccc
tcagcccatgtactggcttgctttggaggagccggtgggcaacacgcttgtgccattgcc
cgggccctgggtatggacactgtgcatattcacaggcacagcgggctgctgtcagcactg
ggactggccttggccgatgtggttcacgaagcacaggagccctgttccctgtcttacaca
cctgaaacctttgcacaactggaccagagactgagccgcctggaggagcagtgtgtggat
gccctgcaggcccagggcttctctaggtctcagatcagcaccgagagcttcctgcacctt
cgctaccaaggcactgactgtgccctaatggtgtctgccaatcagcatccggccacaacc
tgctcaccccgtgctggtgactttggagcagcgtttgtcgagaggtacatgagagagttt
ggcttcatcattcctgagcgctcggtggtggtagatgatgtgcgtgtgaggggaactggc
cgtagtggacttcagctggaggagacctccaaaatccagagtggacctccgcatgtggaa
aaggtgacccagtgctactttgaagggggttatcaggagactcccgtgtaccttttagga
gaactaggctacgggcatcagcttcaagggccctgcctgatcattgacaacaacagcacc
atccttgtagaaccaggttgccaagcggaggtgattgagacaggggacatccgcatttct
gtgggagccgaggctcccagtatgatagacaccaagcttgaccccatccagttgtctatt
ttctcacaccgtttcatgagcattgctgagcagatgggccgcatcctacagcgcacagcc
atctctaccaacatcaaggaacgcctcgacttctcctgtgccctctttgggccagatggg
ggcctcgtctccaatgctccccacattcctgtgcacctgggtgccatgcaagagactgta
cagttccagattcagcacttaggagccgacctccatcctggtgatgtgttgcttagtaac
catcccagtgcagggggcagccatcttcctgacctgactgtcatcacaccggtgttttgg
ccaggtcagtcgaggcctgtgttctacgtggctagccgagggcaccacgcggacattgga
ggtatcaccccgggttctatgcctcctcactctaccacactgcagcaggagggtgccgtt
tttctgtccttcaaactggtccagggaggagtcttccaggaagaggcggtgacagaggcc
ttacaggccccaggcaagatctctggctgcagtgggaccaggaacctgcatgacaacctg
tcggatctccgtgcccaggtggcagctaaccagaaaggcatccagctggtgggagagctg
atcggacagtatggcttagatgtggtgcaggcctatatgggccatattcaggcaaatgct
gaactagcagtgcgagacatgcttcgtgcttttggaacttcccgccaggccaggggcctg
cccctggaggtgtctgccaaggatcacatggacgatggctctcccatctgcctgcatgtt
cagatcaacctgaatcagggcagcgctgtatttgacttcagtggttctgggtctgaggtg
tttggcaatctcaatgcccctcgagccataacactgtctgctctcatctattgcttgcgc
tgtctagtgggccgtgacatcccacttaaccagggttgcctggctcctgtgcaagtcata
attcccaaaggctccatattggatccatccccagaggcagcagtggtcggaggcaacgtg
ctcacatctcagcgagtcgtggatgtcatcctgggggcttttggggcctgtgcagcctcc
cagggctgcatgaacaatgtgaccctgggcaatgcccgtatgggctactatgagacagta
gctggtggtgcgggtgcaggccctggctggcatgggcgcagtggtgtacacagtcacatg
accaacacgcgcattacggacccagagattttggagagccggtatccagttatcctgcgc
cgctttgagctgaggccaggctctggaggccgaggccgcttccggggaggtgatggcgta
gtccgagagctggtctttcgggaagaggcgctactgtctgtcctcacggagcgccgcgcc
ttccagccttatggcctccacgggggagagcctggtacacgtggcttaaacctcctgatc
agaaaagatgggcgcacagtgaatctgggcggcaagacatccgtgactgtgtatcccggg
gacgcgttctgcctccacacgcctgggggtgggggctatggagacccggaggacccagca
ccaccaccaggctcgcccccgctatatccagccttcccagagcgaggcagtgtgtatgag
taccgccgcgcccaggaagcagtatga

DBGET integrated database retrieval system