KEGG   Mus musculus (mouse): 75556
Entry
75556             CDS       T01002                                 

Gene name
Cfap161, 1700026D08Rik, AW047638, AW551802
Definition
(RefSeq) cilia and flagella associated protein 161
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: DUF5552
Other DBs
NCBI-GeneID: 75556
NCBI-ProteinID: NP_083611
MGI: 1922806
Ensembl: ENSMUSG00000011154
Vega: OTTMUSG00000027328
UniProt: Q6P8Y0 C6EQH5
Position
7; 7 D3
AA seq 303 aa
MAQNVYGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSE
DGYVHYGDKVIIVNPDQVLGEEAGKFMRGDLSLCMSPDEVKAQLSDDLEIPCGVSAVQTI
APMGRNTFTILSDGANSCEMGQVVVYGQNFCLGIAAGLEGKMLYLTSDHRTLLKSSLKSG
LQEVTLTDEVTHLNCWQAAFLDPQLRLEYEGFPVRANEKIVIYHRHTNRALAVHRNLFLR
TYFGKEMEVVAHTYLDSHKVEKPKNQWMLVTGNPRNKSNTMLDISKPITEDTRALEQAMG
INT
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcgcagaacgtgtatggtcctggagtgcggatgggcaactggaacgaagatgtctat
ttggaggaggagcgcatgagacacttcctagagaagagggaaaaaggagaacttcttatt
cagagaaacagaagagtgaagaagaacattttgagaccgatgcagctttcggtatcggaa
gatggatatgtccactatggcgataaagtgatcattgtgaatcctgaccaagtcctgggg
gaggaagctggcaagtttatgagaggagacctgagcctgtgtatgagcccagatgaagtt
aaagcgcagcttagtgatgacttagagataccctgtggtgtgagtgctgtgcagaccatc
gccccgatgggcaggaacaccttcaccattttgagtgacggcgcaaacagctgcgaaatg
ggccaagtggttgtctatgggcagaacttctgcctggggatagcagcaggactggaaggc
aagatgctgtatctaacaagtgaccacaggacccttttgaagtcttctctgaagtccggc
ctacaggaggtgactctgacagatgaggtcacccatctgaactgctggcaggctgccttc
ctcgatccccagctgcgcctggaatatgagggcttcccagtgagggcaaatgaaaaaatt
gtcatctatcatcgtcacacaaaccgagccctggcggtccaccggaatctcttcttaagg
acctactttgggaaggaaatggaggttgtagctcacacatatctggactcacacaaagta
gaaaaacccaagaaccagtggatgctggttactggaaatcccaggaacaagtcgaacacc
atgctagacatctccaaacccatcacagaggatacgcgcgccttggagcaggccatgggc
atcaatacatag

DBGET integrated database retrieval system