KEGG   Mus musculus (mouse): 75560Help
Entry
75560             CDS       T01002                                 

Gene name
Ep400, 1700020J09Rik, AU023439, mDomino, mKIAA1498, p400
Definition
(RefSeq) E1A binding protein p400
  KO
K11320  E1A-binding protein p400 [EC:3.6.4.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    75560 (Ep400)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     75560 (Ep400)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     75560 (Ep400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EP400_N SNF2_N HSA Helicase_C Myb_DNA-binding Myb_DNA-bind_4 Myb_DNA-bind_6 HDA2-3
Motif
Other DBs
NCBI-GeneID: 75560
NCBI-ProteinID: NP_083613
MGI: 1276124
Ensembl: ENSMUSG00000029505
Vega: OTTMUSG00000017135
UniProt: Q8CHI8
Position
5; 5 F
AA seq 3035 aa AA seqDB search
MHHGSGPQNVQHQLQRSRSFTGSEEEQPAHPNLPPSPAAPFAPSASPSAPQSPGYQIQQL
MSRSPVAGQNVNITLQNVGPVVGGNQQITLAPLPLPNPTSPGFQFGAQQRRFEHGSPSYI
QVTSPMSQQVQTQSPTQPSPGPGQTLQNVRAGAPGPGLGICSNSPTGGFVDASVLVRQIS
LSPSSGGHFVFQEAPGLTQMAQGAQVQLQHSGAPITVRERRLSQPHAQSGGTIHHLGPQS
PAAAGGTGLQPLASPNHITTASLPPQISSIIQGQLIQQQQQVLQGQPMNRSLGFERTPGV
LLPGVGGPSAFGMTSPPPPTSPSRTTMPPGLSSVPLTSMGSSGMKKVPKKLEEIPPASQE
MAQMRKQCLDYHYKEMEALKEVFKEYLIELFFLQHLQGNMMDFLAFKKKHYAPLQAYLRQ
NDLDIEEEEEEEEEEEGKSEVINDEHQSLTGSLVVGPGSATEADPFKRQQVMPPTEQSKR
PRLEVGHPGVVFQHPGVNAGVPLQQLMPTVQGGMPPTPQATQLTGQKQSQQQYDPSTGPP
VQNAASLHTPPPQLPARLPPASVPATALPSTLQFSQQSQMVEASTQLQIPVKTQQLNAPI
PAPLPSQLPAPSSQPAQPALHVPMPGKAQMQTSQLSSQTQTVASTRPPLDSAQPCQRSLP
TSSSSSSLVPVSGSGPGPSPARSSPVNRPSSATNKALSPITSRSPGVAVSAPPKPQSPAQ
NAASSQDGSQDKLAEQITLENQIHQRIADLRKEGLWSLRRLPKLQEAPRPKSHWDYLLEE
MQWMATDFAQERRWKLAAAKKLVRTVARHHEEKKLREERGKKEEQSRLRRIAATTAREIE
YFWSNIEQVVEIKLQVELEEKRKKALNLQKVSRRGKESRLKGFDTSPEHSLDLGISGRKR
KASTSLTDDEVEDEEETIEEEEAHEGLVDHHTELTNLAKEAELPLIDLMKLYEGAFLPNF
QWPQPEPDHEESSGEEDVEDCPSDRESRRDSVLIDSLFIMDQFKAAERMSIGKSNTKDIT
EVTAVAEAILPKGSARVTTAVKFSAPSLLYGALRDYQKIGLDWLAKLYRKNLNGILADEA
GLGKTVQIIAFFAHLACNEGNWGPHLVVMRSCNILKWELELKRWCPGLKTLSYVGSHREL
KAKRQEWTEPNNFHICITSYKQFFRGYTAFSRVHWKCLVVDEMQRVKGMTERHWEAIFKL
QSQQRLLLIDVPLHNTFLELWTMVHFLIPGISRPYLSFPLKAPNEENQDYYHKMVIRLHR
VTQPFILRRTKRDVEKQLTRKYEHVLKCRLSSRQKALYEDVILQPRTQEALKSGHFVSVL
SVLTRLQRICNHPGLVEPRVPGSSFAAGSLQYKSASLILRVLEREFWKETDLSIFDLIGL
ENKITRHEAELLCKKKVTRKLMEEVFASPPPSARPAAVKLKASRLFQPVQYGQKPEGRTV
AFPSTHPPRMANTNTSTATPQGQVRGRPPIATFSANPDTKGGEVVKIAQLASIAGPQSRV
AQPETPVTLQFQGNKFTLSHSQLRQLTAGQPLQLQGSVLQIVSAPGQPYLRAPGPVVMQT
VSQAGAVHSTLGSKPPTSGPSPAPLTPQVGVPGRVAVSAMAVGEPGLASKPASPAAGPTQ
EEKSRLLKERLDQIHFINERRCSQAPVYGRDLLRICSLPGRRKRPLCWSLDSNFGKGPKG
VNYDMSLSKSEGDLILTLSQESLQDVLGRVACVIPPVVATPPSLWVARPPSLYSSRLRAL
RQCLREHTGPYHRQLQQLTALRSLQFPELRLVQFDSGKLEALAILLQKLKSEGRRVLILS
QMVLMLDILEMFLNFHYLTYVRIDENANSEQRQELMRSFNRDRRIFCALLSTHSRATGIN
LVEADTVVFYDNDLNPVMDAKAQEWCDRIGRCKDIHIYRLVSGNSIEEKLLKNGTKDLIR
EVAAQGNDYSMAFLTQRTIQELFEVYSPMDDTGFPVKAEEFVVLSQEPSVSETIAPKIAR
PFIEALKSIECLEEDAQRSTEEAVPGSSSVAVSSDSDGSRYDEEPSQLEELADFMEQLTP
IEKYALNYLELFHTTTEQEKERISEDLVMASMKDWETRNARALQEREARLQLEQEEAELL
TYTREDAYTMEYVYEDADGQTEVMPLWTPPTPPQDDNDIYIDSVMCLMYETTPIPEAKLP
PVYVRKERKRHKTDPSAAGRKKKQRHGEAVVPPRSLFDRATPGMLKIRREGKEQKKNLLL
KQQTPFAKPLPTYVKSSGEPAQDSPDWLIGEDWALLQAVKQLLELPLNLTIVSPAHTPNW
DLVSDVVNSCSRIYRSSKQCRNRYENVIIPREEGKSKNNRPLRTSQIYAQDENATHTQLY
TSHFELMKMTAGKRSPPIKPLLGMNPFQKNPKHASVLAESGINYDKPLPPIQVASLRAER
IAKEKKALADQQKAQQPPVTQPPPQQQQQQQQQQQQQQQQQQPPPPPQQPPPPVPQPQAA
SSQTPAGQPAVQPQPQPQVQTQPQPVQPQSKGQPTMTTVGSAAVLAGTIKTSVTGTSIPT
GTVSGNVIVNTIAGVPAATFQSINKRLASPVAPGTLTTSGGSAPAQVVHTQQRAVGSPAT
ATTDLVSMTTTQGVRAVTSVTASAVVTTNLTPVQTPTRSLVTQVSQATGVQLPGKTITPA
AHFQLLRQQQQQQQQQQQQQQTSQVQVPQLQSQAQSPAQIKAVSKLGPEHIIKMQKQKMQ
LPPQPPPPQAQPGPPQQPAQVQVQTPQPPQQQQSPQLTTVTAPRPGALLTGTTVTNLQVA
RLTRVPTSQLQAQGQMQTQTPQPAQVALAKPPVVSVPAAVVSSPGVTTLPMNVAGISVAI
GQPQKTAGQTVVAQPVNVQQLLKYKQQTAVQQQKAIQPQVAQGQAAVQQKLTTQQITTQG
PQQKVAYAAQPALKTQFLTTPISQAQKLAGTQQVQTQIQVAKLPQVVQQQTPVASIQQVA
SASQQASPQTVTLTQATAAGQQVQMIPTVTATAQLVQQKLIQQQVVTTASASLQTPGGPS
PAQLPASSDSPSQQPKLQMRVPAVRLKTPTKPPCQ
NT seq 9108 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatggcagtggtcctcagaatgtccaacatcagctgcagaggtctaggtccttc
actgggagtgaagaggagcagccagcccatcccaacttacccccatctcctgcagcgcct
ttcgctccatcagccagtccatctgcaccccaatcccctgggtaccagatacagcagctg
atgagcagaagtcctgtggccgggcagaatgtgaacatcacactgcagaatgttggccca
gttgtgggaggaaaccagcagatcacactggcccccctgccactgcccaaccccacttct
ccaggttttcagtttggtgcccagcaaaggcgctttgagcatggctctccatcatacatt
caagttacttctccgatgtcgcagcaggtccagactcaaagccccacacagcctagccct
gggccagggcaaaccctgcagaatgtgcgtgcaggtgctccaggtcctgggctgggcata
tgcagcaacagccccactggaggctttgtggatgccagtgtgcttgtgaggcagatcagc
ttgagtccatcaagtggtggtcactttgtatttcaggaggcaccaggcctgactcagatg
gcccagggagcccaggttcaactccagcattcaggagctcccatcactgtccgagaacgg
agactctcccaacctcatgcacagtcgggaggcaccatccaccatctagggcctcagagc
cctgcagctgcaggaggcactggacttcaacctctggccagcccaaaccacatcaccacg
gccagcctgccaccccagatcagcagcattattcagggccagttgatacagcaacagcag
caggtgcttcagggacagccaatgaaccgatctctgggatttgagaggacacctggtgtg
ctgcttcctggcgtgggagggccttcagcatttgggatgacatccccaccaccacccacc
agcccttccagaaccaccatgcctccaggcctttccagtgtgcctcttacatctatggga
agctcaggaatgaagaaggttcccaagaagttggaggagatccccccagcctcccaagag
atggcacagatgaggaagcagtgtctggactaccactacaaggaaatggaggcactcaag
gaagtcttcaaggagtacctgattgaactgttcttcttgcaacatctacagggaaacatg
atggatttcttggcttttaaaaagaagcactatgcccctttacaagcgtatcttaggcag
aatgatttggacattgaagaggaggaggaggaagaggaagaggaggaaggaaaatctgaa
gttatcaacgatgagcaccaatccctgactgggagcctagtggtggggcctggcagtgcc
acagaagccgacccctttaagaggcaacaggtgatgccacccacagagcagtctaagaga
cctcgtcttgaagtgggtcatccaggggtagttttccagcatccaggggtgaatgcagga
gtccctctgcagcagttaatgccaacagtccaaggagggatgcccccaactcctcaggcc
acacagctcactggacagaagcagagtcagcagcagtacgacccttccacagggcctcct
gtgcagaacgccgccagcttgcataccccaccaccacagcttcctgcgaggctgcctccg
gccagtgtcccagccacagccctcccttccaccttacagttttcacagcagtcacagatg
gtggaggcttcaactcagctccaaatccctgtgaagactcaacagctaaatgcccccatc
cctgcccccctgcccagccagctccctgctccttcttcacagcccgcccagccggcccta
catgttccgatgcccgggaaggcgcagatgcagacatctcagctttcctcccagacccag
acagtggcatcgaccaggccccccttggactctgcccagccctgccagcggtctctgccc
acttcctcctcttcctcatcccttgtacctgtgagtggctcaggtcctggaccctcacct
gctcgttcttcaccagtgaacagaccctcttctgctaccaacaaggctctgtctcccatc
acttctcggtctccaggggtggcagtatcagctcctcctaagccacagagtcctgctcag
aatgcagcctcatcccaggacggttctcaggataaactggcagaacaaataacactggaa
aaccagatccatcagcgaatagcagatttaaggaaggaaggcttgtggtccctaaggcgg
ttgccaaagcttcaagaggccccacgcccgaaatctcactgggactatttgctggaagag
atgcagtggatggccacagactttgctcaagagcggaggtggaagttggctgctgctaag
aagcttgtcagaactgtagcccggcatcatgaggaaaagaaacttcgtgaggaaagaggg
aagaaggaagaacagagcagactgaggcgcattgctgccactactgccagagaaatagaa
tatttttggtcaaatattgaacaggttgtggaaataaaattacaagtagaattagaagag
aaaagaaaaaaagccttaaatttacagaaagtttccagaagaggtaaagagtccagatta
aagggatttgatacatcaccagaacactctctggatctaggaatatctggaaggaaaaga
aaagctagcacatctttgactgatgatgaagtggaagatgaagaagagaccattgaagag
gaggaagcacacgaagggcttgtagaccaccacacagaacttactaatctggccaaagaa
gctgagttgcccttaatcgatttgatgaagttgtatgaaggtgcctttctgccaaatttt
cagtggccacagcctgaacctgatcatgaagagtcaagtggggaagaagatgtagaagac
tgtcctagtgacagggagagccggagggactccgttctcattgactcactcttcatcatg
gatcagtttaaagctgcagagagaatgagcattggaaaatccaacaccaaggacatcaca
gaagttactgctgtggctgaagccatcctccctaagggcagtgcccgagtcacaactgcg
gtgaagtttagtgctccatctttgttgtatggtgctctccgagactatcagaagataggc
ctggactggttggccaagctataccggaagaatctcaatggcatattggctgatgaagca
gggcttgggaaaactgtgcagatcattgctttttttgctcaccttgcctgtaatgaaggt
aactggggccctcatcttgttgtcatgaggagttgtaacatactcaagtgggaactcgag
ttgaaacgctggtgtcctggcctcaaaactctttcttatgttggcagccacagagaactc
aaagcaaagagacaggagtggaccgagcccaataacttccacatctgcatcacgtcctat
aagcagttcttcaggggctacactgccttctcaagggtgcactggaaatgccttgttgtt
gacgaaatgcagagggtgaagggcatgactgagcggcactgggaagccatcttcaagctg
cagagccagcagcgcctgcttctgatcgatgttcctctgcacaacactttcctggagctc
tggaccatggtgcacttcctcattcctgggatctccaggccttatctgagctttcctctg
aaagcccccaatgaggaaaaccaggattactatcacaaaatggtcataaggttacacagg
gtcacacagccatttattttgaggagaaccaagagagatgtggagaaacagctaaccagg
aaatatgagcatgttctgaagtgccgcctttccagtcgtcagaaggccttatatgaggat
gtcatcctacagcctaggactcaggaagctctgaagagtggacattttgtcagtgtcttg
agtgttctgacacggctacagcgaatctgcaaccatcctggactagtagagccacgggta
ccaggctcctcctttgcagcaggctctctgcagtataagtcagcctctctaattctcaga
gttctggagagagagttctggaaggaaaccgacctttctatatttgatctcattgggcta
gaaaataaaatcactcgccatgaagctgaattactgtgtaagaaaaaagtgactcggaaa
ctcatggaggaagtctttgcttcacctcctccgtcagcccgaccagcagcagtgaagctc
aaggccagcaggttatttcagcctgtgcaatatggccagaagcctgagggtcgcactgtg
gcattccccagcacacatccacctcggatggcaaacaccaacacatccaccgccactcca
cagggccaggttcgaggacggccgccgattgctactttctctgccaacccagatacaaaa
ggtggggaagtagtgaaaatagctcagctggcgtctattgcagggccacagagccgtgtg
gcccagccagagacacctgtgacactacagttccaagggaacaaattcaccttgtcacat
agccagctgcggcagctcacagcaggccagcctctgcagctgcaaggtagtgtactccag
atcgtgtcagcccctggacagccctaccttcgagcccctggccctgtggtgatgcagact
gtgtctcaggcaggtgctgtgcatagcaccctggggagcaagcccccaaccagtggcccc
agccctgcacccttgaccccacaagttggtgttccgggtcgagtagcagtgagtgctatg
gctgttggagaacctggcctggcttccaaaccagcttctcctgctgcagggccaacccag
gaggagaagagccgacttttgaaggaacggttggatcagattcattttatcaatgaacga
cgttgttcccaggctccagtgtatggcagagacttgctgaggatttgttcccttcctgga
agaaggaagaggcctttgtgctggtctttggatagcaactttgggaagggtcctaaagga
gtaaactatgacatgtcactctcaaagagtgaaggtgatctgattttgacattgagtcaa
gagtctcttcaagatgttcttggcagggtggcctgtgtgattcctccagtggtggctaca
ccaccctccctgtgggtcgcgaggccgccctcattgtatagcagcaggttgagagctctg
aggcagtgcctgagggagcacaccggtccttaccaccggcagctgcaacaactaacagca
ctgcgctcactgcagttcccggagctgaggctggtgcagtttgactcagggaagttagaa
gctttagcaatcctgctacagaaactaaaatctgaaggacgtcgggtactgattttatct
cagatggttcttatgctagacattttagagatgttcttgaacttccattatctcacttat
gtacggattgatgaaaatgccaacagtgaacaacgacaggagctgatgaggagcttcaac
agagacaggcggattttctgtgcccttctctctacccatagtcgtgccactggcataaac
cttgttgaggctgacactgtggtgttttatgacaatgacctaaatccagttatggatgcc
aaagcccaggagtggtgtgatagaattgggaggtgcaaggacatccacatatacaggctt
gtcagtggcaattctattgaagagaaattgttaaaaaatggaactaaagatttgatccgt
gaagtagctgctcaaggaaatgactattcaatggccttcttaacgcagcgaactatccag
gagctgtttgaagtctactcacctatggatgatactggctttcctgtgaaagctgaggaa
ttcgtggtgctttctcaggaaccatctgtcagtgaaactatcgcacccaagattgcaaga
cctttcatagaggccctcaagagcatcgagtgtctggaggaagatgcacagaggtccaca
gaggaagctgtgcctggatccagcagtgtagctgtctcctcagactcagatggctctaga
tatgacgaggaaccatcacagctggaggagctggctgactttatggaacagcttactcca
attgaaaaatatgcattgaattacttggaattgttccatacgaccactgaacaagaaaaa
gagagaatcagtgaggatttggtaatggcgtcaatgaaggactgggaaacccgaaatgct
agagccctgcaggaaagggaggcccggctacagctggagcaggaggaggcagagctcctc
acctacactcgggaggacgcctatactatggagtatgtctatgaagatgctgatggacaa
acagaagtcatgccgctctggacaccacccacccctcctcaggatgacaatgatatctac
attgactcagttatgtgtctcatgtatgagaccacacccatcccagaagctaagctgcct
cctgtttatgtgaggaaggagcgcaagcggcacaaaacagacccctcagctgcaggccgg
aagaagaagcagcggcatggtgaggcagttgtcccgccccggtccttgtttgaccgggca
acacctggtatgttgaaaatccggcgtgaaggcaaagagcagaagaagaacctgctgctg
aagcagcagacaccttttgccaagcctctgcccacctatgtcaagtcctcaggggaacct
gcccaggacagtcctgactggctcattggcgaggactgggccttgctacaggctgtaaag
cagttgcttgagctgcccttgaacctcacgattgtgtcacctgcccacactcctaattgg
gaccttgtcagtgatgttgtcaactcctgtagtcgaatctaccgttcttccaagcagtgc
cggaatcgttatgagaacgtcatcattcccagggaggaggggaagagtaagaacaatcgt
cctctccgcacaagccagatttatgctcaggatgaaaacgccactcacacccagttgtac
acgagccactttgagctgatgaaaatgacagctggcaagagaagccccccaatcaagcct
ctgcttggcatgaatccctttcagaagaaccccaagcatgcctctgtcctggcagaaagt
ggaatcaactatgacaagccgctgcctcccattcaagttgcatctctccgtgcagagcga
attgcaaaagagaaaaaggctttggctgatcagcagaaggcacagcagccaccagtgaca
cagccgccccctcagcaacaacagcagcagcaacagcagcagcagcagcaacagcagcag
cagcaacccccgccacctccacagcagccaccaccaccagtgccgcagccacaggcagca
agcagtcagacaccagcagggcagcctgctgtccagccccagccccagccccaggtccag
acccagccacagcctgtgcagccacagtcaaaggggcagcccacaatgacgactgtgggc
agtgctgctgtgctggcaggaaccattaaaacatcagtcactggaacaagcatccctaca
gggactgtaagtggaaatgtgattgtgaacacaatagctggtgtccctgctgctactttc
cagtccattaacaagcgtctggcatcacctgtggctcctggaactttgactacgtctgga
ggttctgctcctgctcaggtggtccacactcaacaacgagcagttggttccccagccact
gccaccactgacctggtatccatgacaactactcaaggtgttcgagcagttacttcagtg
acggcctcagctgtggtcactaccaacctgactccagtgcagactccaacccgttcctta
gtaacccaggtgtctcaagccacaggggttcagctacctggaaaaaccatcacccctgct
gctcatttccagcttcttaggcagcagcagcaacagcagcagcagcagcagcagcaacag
cagacttcccaggtgcaagttccacagctccagagccaggcccaatctcctgcacagatc
aaagctgtgagcaagctaggaccggaacacatcatcaagatgcagaaacagaagatgcag
ctgccaccacagcccccaccaccgcaggcccagccaggtcccccacagcaaccagcgcaa
gtgcaagtacagactccacagcccccacagcaacagcagagtcctcagcttaccacagtc
acggccccacggcctggggctttgctcacaggcaccacagtgaccaaccttcaggtggcc
cggcttacccgagtccctacttctcagctgcaggcacaagggcagatgcaaactcagacg
ccccagcctgctcaggtggccttggcaaagcctccggtggtatctgtcccagcagctgtg
gtctcctcgccaggggtcacgaccctgcctatgaacgttgcagggatcagcgtggcaatt
ggacagccacaaaaaacagcagggcagacggtcgtggcccaacccgtcaatgtccaacag
ctgctgaagtataagcagcagacagccgtccaacagcagaaggccatccagccacaagtt
gcccagggccaggctgctgttcagcagaagctgaccacccaacagatcactactcagggc
ccgcagcagaaggtcgcttatgctgcccagccagcccttaaaacccagtttctgaccaca
cccatctcccaggcccagaaactggccgggactcagcaggttcagactcagatccaggtt
gcaaaacttcctcaagttgtgcagcaacaaacacctgtggccagtatacaacaagttgca
tcagcttctcagcaggcttctccacagacggtgacgctcacacaggcaacggcagcaggg
caacaggtacagatgatcccaacggtgactgcaacagcccagctggtgcagcagaagctc
atccagcagcaggtggtgacgacagcctcagcatcactgcagacccctggtggcccaagc
ccagcacagcttccagccagctctgacagcccaagccagcagccaaagttgcaaatgaga
gttcctgctgtgaggctgaagacgcccaccaaacctccatgccagtag

DBGET integrated database retrieval system