KEGG   Mus musculus (mouse): 75570
Entry
75570             CDS       T01002                                 

Gene name
Nhej1, 1700029B21Rik, XL, XLF, cer, cernunnos
Definition
(RefSeq) non-homologous end joining factor 1
  KO
K10980  non-homologous end-joining factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    75570 (Nhej1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    75570 (Nhej1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     75570 (Nhej1)
SSDB
Motif
Pfam: XLF
Other DBs
NCBI-GeneID: 75570
NCBI-ProteinID: NP_083618
MGI: 1922820
Ensembl: ENSMUSG00000026162
Vega: OTTMUSG00000021757
UniProt: Q3KNJ2
Position
1; 1 C4
AA seq 295 aa
MEELEQDLLLQPWAWLQLAENSLLAKVSITKHGYALLISDLQQVWHEQVDTSVVSQRAKE
LNKRLTAPPAALLCHLDEALRPLFKDSAHPSKATFSCDRGEEGLILRVQSELSGLPFSWH
FHCIPASSSLVSQHLIHPLMGVSLALQSHVRELAALLRMKDLEIQAYQESGAVLSRSRLK
TEPFEENSFLEQFMAEKLPEACAVGDGKPFAMSLQSLYVAVTKQQIQARQAHKDSGETQA
SSSTSPRGTDNQPEEPVSLSSTLSEPEYEPVAASGPMHRARLVKSKRKKPRGLFS
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaagagctagagcaagacctgttgctgcagccatgggcatggttacaacttgcggag
aactcactcttagccaaggtgtctatcaccaagcacggttatgccttgctgatttcggat
cttcaacaggtgtggcatgaacaggtggacacttcggtggtcagccagcgagccaaggag
ctgaacaagcgcctcactgcgcctcctgcagctttgctctgtcacctggatgaagcactt
cgcccactgtttaaagattctgctcaccctagcaaagctactttctcctgtgaccgagga
gaggagggactgatcctgcgggtgcagagtgagctctcgggtcttcccttcagttggcat
ttccactgtattccagctagttcttcactggtctctcagcatttgattcatcctctgatg
ggtgtgagcctggcactgcagagtcatgtgagggagctagcagcattgcttcggatgaag
gaccttgagatccaggcctaccaggagagtggggctgtgctgagccgaagtcgattgaag
acagagccatttgaagaaaattctttcttggaacagtttatggcagagaaattgccagag
gcgtgtgctgttggtgatggaaagccatttgccatgagtctgcagagtctgtatgtggca
gttacaaaacagcagatccaagcaaggcaggcacataaagactctggagagactcaggca
tcaagcagcacctcccctcgaggaactgataaccagccagaagagccggtctccctctct
tccaccctctcagagcctgaatatgagcctgtggctgcttcaggccctatgcatagagct
cggctggtgaagtccaagaggaagaagcccaggggactcttcagttaa

DBGET integrated database retrieval system