KEGG   Mus musculus (house mouse): 75580
Entry
75580             CDS       T01002                                 
Symbol
Zbtb4, 2310026P19Rik, 9230111I22Rik, mKIAA1538
Name
(RefSeq) zinc finger and BTB domain containing 4
  KO
K10491  zinc finger and BTB domain-containing protein 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    75580 (Zbtb4)
   04121 Ubiquitin system [BR:mmu04121]
    75580 (Zbtb4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    75580 (Zbtb4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     75580 (Zbtb4)
SSDB
Motif
Pfam: BTB zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2HC_2 zf-C2H2_jaz HVO_2753_ZBP Ribosomal_L34e
Other DBs
NCBI-GeneID: 75580
NCBI-ProteinID: NP_083624
MGI: 1922830
Ensembl: ENSMUSG00000018750
UniProt: Q5F293
Position
11:69656738..69674852
AA seq 982 aa
MPPPAEVTDPSHAPAVLHQLNEQRLRGLFCDVTLIAGDTKFPAHRSVLAASSPFFREALL
ASAPLPLPPVTGGSAPSPATTTAASSSSSSPPPASPHSSSPPRVLELPGVPAAAFSDVLN
FIYSARLALPGGGGDGAAVAEIGALGRRLGISRLQGLGEGGDTWVPPAPTSMVTSDPTED
GLGAGPRTDGEWVGDKAEALTPDSQPRRPFPCPRCGKSFIHPKRLQTHEAQCRRGSNTRG
SAGLGPGVSGSGGPAGVDASALPQPVGFRDGPEHVVKVVGGHVLYVCAACERSYVTLSSL
KRHSNVHSWRRKYPCRYCEKVFALAEYRTKHEVWHTGERRYQCIFCWDTFVTYYNLKTHQ
RAFHGISPGLLASEKTPNGGYKPRLNTLKLYRLLPMRAAKRPYKTYSQGAPEAPLSPSLH
TPAPAAMPASPQPLPPPAPEPGPPPSVITFAHPAPSVIVHGSSSSGAAGGGPAGTGGSQA
ASVITYTTPPRPPKKREYPPPPPEPTATPTSPASTAVSPATAAGPATATEEAKGRNLRAG
RTLTYTAKPVGGLSGSGGSPTGTGRGSSQLQAPPPLCQITVRIGEEAIVKRRISETDLRP
GELSGEEVEESEEEEEEEEEEDQEEQEESKAGGEDQLWRPYYSYKPKRKAGATAGGASGV
SGLPRGRRPPRWRQKLERRGWEETPSVEGPGGRGRGERRHRCGDCAQAFATVRKLRKHQE
AHSGGSHTSRTGRRSSTRFTCPHCAKVCKTAAALNRHGQRHAVERPGGTPTPVIAYSKGS
IGTRPTDVKEEAPQEMQVSSSSGEAGSGSAAAAEASESASLQDPVISGGEEPPVAGGGSY
VYPPVQEFPLALIGGSREPSAGKGKPGNEGSLGASEGDRMEGMGTAKVTFYPEPYPLVYG
PQLLAAYPYNFSNLAALPVALNMVLPDEKGGGALPFLPGVFGYAVNPQAAPPTPPPPLPL
PVSPKGIGGMTGVERTQKGDVG
NT seq 2949 nt   +upstreamnt  +downstreamnt
atgccaccccctgcagaggtgacggacccatcccatgccccagctgtcctgcatcagctc
aatgagcagcggctccgtggcctcttctgtgacgtcaccctcatagctggagacaccaag
ttccctgctcaccgcagtgtcctggccgcctctagtcccttcttcagagaagccctacta
gcttcagccccactgccccttccaccagttactggcggctcagcccccagccccgcaacc
accacagctgcctcctcttcgtcctcctctccccctccagcctctcctcactcttcatct
cctccccgggtgctagagctgcccggggtcccagcagctgccttctccgatgtcctcaac
ttcatctatagtgcccggcttgcactccctggcggtggtggggatggggcagctgtggca
gagattggagctctgggccggaggctgggtatctcccgtctacagggcctgggggaagga
ggtgatacttgggtaccacctgccccaacttccatggtcacctcagatcctactgaggat
ggtttgggggcagggcctagaacagatggagagtgggtgggtgacaaagctgaggccctg
actcctgactcccagccccggcggccctttccttgccctcgatgtggaaaaagcttcatc
catcccaagcgactacagacccacgaggctcagtgtcgacgagggtccaacactcggggg
tctgcagggctggggcctggagtctctggctctgggggtcctgcaggagtggatgcctct
gccctgccacaaccagtgggcttcagagatggccctgagcatgtggtgaaggttgtgggc
ggccacgtgctctatgtgtgtgcggcctgtgagcgttcctacgtgaccctgtccagcctg
aagcggcacagcaatgtacactcgtggcggaggaagtacccctgccgctactgtgagaag
gtgtttgccctggctgagtaccgcaccaagcacgaggtgtggcacactggggagcgcagg
taccagtgcatcttctgctgggacacctttgtcacctattataacctgaagacccaccag
cgagccttccatggcattagccctggcctcctagccagtgagaagacacccaatggaggc
tacaaacccaggcttaataccctcaagctgtaccgcctgctccctatgcgggcggccaag
cggccctacaagacctacagtcagggagcccctgaggcccctctttctccaagcctccac
acaccggcccccgcggcaatgccagccagcccccaacccctacccccacccgccccagag
cctggtcctcccccctctgtcatcacctttgctcatccggctccctctgtcattgtccac
gggagcagtagtagtggtgcagccgggggcggaccagccggcacaggagggtcccaagct
gcctcagtcatcacttatacgactcccccaagaccccccaagaaacgagagtacccacct
cctccccctgagcctacagcaacacccaccagcccagcctccaccgccgtcagcccagcc
acagctgcagggccagccacagccacagaggaggccaagggccggaatctgcgggctggg
aggactctgacttacacagccaaacccgtgggtgggttgagtgggagtgggggttccccc
acagggactggccgaggctcttctcagcttcaggctccacctccactgtgtcagatcact
gtgcgaattggggaagaggccattgtcaagcgccgcatctcagaaactgacctgcgtcct
ggagagctgagtggagaggaagtagaggagagcgaggaagaggaggaggaagaggaggag
gaggaccaggaggaacaagaggaatcgaaggctggaggggaagatcagctttggagaccc
tactattcatacaagcctaagcgcaaggctggagctactgccggcggggccagcggggtc
agtggactgccccgaggacgaagaccaccacgctggaggcaaaagctggaacgaaggggc
tgggaggagaccccatcagtggagggcccaggaggacgaggacgtggtgagcgtaggcac
cgttgtggggactgtgcccaggcctttgccactgtgaggaagctgagaaagcaccaggaa
gcccatagtggaggctcccacacctccaggactgggaggaggtcttccacccgcttcacc
tgtccccactgtgccaaggtgtgcaagacggcagctgccctgaaccgacatgggcaaagg
catgctgtggaacggcccgggggcactcccacacctgtcattgcctattccaaaggaagc
attggcaccaggcccactgacgtcaaggaggaggccccccaggagatgcaagtgtcctct
tccagtggggaggcaggcagtggtagcgctgccgctgctgaagcttctgagtctgcctca
ctccaggacccggtcatctctgggggtgaggagcctccagtagcaggtgggggcagctat
gtatacccacctgtgcaggaatttcccctggccctgataggaggcagccgggagcccagt
gccggcaaaggaaaacctgggaatgagggttccttgggagcttctgagggtgaccggatg
gaggggatggggactgccaaagtcaccttctaccctgagccctacccacttgtctatggc
ccccagctccttgctgcctacccttacaacttcagcaacttggctgctctcccagttgct
ctcaacatggtcctacctgacgaaaaaggtggtggggcccttcccttcctaccaggggtc
tttggctacgcagtgaatcctcaagcggcgccacccactccccctccccctctccctctg
ccagtttcccctaagggaatagggggaatgacaggggtagagagaacccagaagggggat
gtggggtga

DBGET integrated database retrieval system